Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[80 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3953001 299 1 Q99623(PHB2_HUMAN) RecName: Full=Prohibitin-2;AltName: Full=B-cell receptor-associated protein BAP37;AltName: Full=D-prohibitin;AltName: Full=Repressor of estrogen receptor activity;
QUERYSEQ
MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNA
SQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q99623(PHB2_HUMAN)]

299
region name description
2-299 CHAIN /note="Prohibitin-2" /id="PRO_0000213884"
19-49 REGION /note="Necessary for transcriptional repression"
121-124 REGION /note="LC3-interaction region"
150-174 REGION /note="Necessary for transcriptional repression"
190-238 COILED ECO:0007744|PDB:6IQE"
1-299 DISORDER predicted by DISOPRED

MONOMER
299
pdb_id a1 identity[%]2 description
6iqe A 100.0 PHB2_HUMAN Prohibitin-2
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HOMO
299 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6iqe[2] A PHB2_HUMAN Prohibitin-2[59 aa] A 100.0
/100.0
17
/17
PHB2_HUMAN Prohibitin-2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.