Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[60 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1682730 498 1 Q13568(IRF5_HUMAN) RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ;
QUERYSEQ 
MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEEL
QRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP
SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDL
KDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q13568(IRF5_HUMAN)]

498
region name description
1-498 CHAIN /note="Interferon regulatory factor 5" /id="PRO_0000154558"
14-122 DNA_BIND /note="IRF tryptophan pentad repeat"
121-207 REGION /note="Disordered"
478-498 REGION /note="Disordered"
169-206 COMPBIAS /note="Pro residues"
1-498 DISORDER predicted by DISOPRED

MONOMER
498
pdb_id a1 identity[%]2 description
3dsh A 99.6 IRF5_HUMAN Interferon regulatory factor 5 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HOMO
498 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3dsh[2] A IRF5_HUMAN Interferon regulatory factor 5[236 aa] A 98.4
/99.6		 62
/62		 IRF5_HUMAN Interferon regulatory factor 5
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.