Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[30 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3661393 274 12 P59632(AP3A_SARS) RecName: Full=ORF3a protein;AltName: Full=Accessory protein 3a;AltName: Full=Protein 3a;AltName: Full=Protein U274;AltName: Full=Protein X1;
QUERYSEQ 
MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPLLYDANYFVCWH
THNYDYCIPYNSVTDTIVVTEGDGISTPKLKEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59632(AP3A_SARS)]

274
region name description
1-274 CHAIN /note="ORF3a protein" /id="PRO_0000106131"
1-34 TOPO_DOM /note="Extracellular"
35-55 TRANSMEM /note="Helical"
56-78 TOPO_DOM /note="Cytoplasmic"
79-99 TRANSMEM /note="Helical"
100-104 TOPO_DOM /note="Extracellular"
105-125 TRANSMEM /note="Helical"
126-274 TOPO_DOM /note="Cytoplasmic"
33-141 DOMAIN /note="CoV 3a-like viroporin TM"
145-237 DOMAIN /note="CoV 3a-like viroporin CD"
1-274 DISORDER predicted by DISOPRED

MONOMER
274
pdb_id a1 identity[%]2 description
8eqs B 100.0 AP3A_SARS ORF3a protein 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
274 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7kjr[4] C APOA1_HUMAN Apolipoprotein A-I[31 aa] A 83.3
/76.6		 6
/6		 AP3A_SARS2 ORF3a protein
7kjr[4] D APOA1_HUMAN Apolipoprotein A-I[31 aa] A 83.3
/76.6		 6
/6		 AP3A_SARS2 ORF3a protein
8equ[2] C SAP_HUMAN Saposin-A[80 aa] A 85.7
/76.4		 7
/7		 AP3A_SARS2 ORF3a protein
8equ[2] F SAP_HUMAN Saposin-A[80 aa] A 0.0
/76.4		 1
/1		 AP3A_SARS2 ORF3a protein
8equ[2] D Saposin A, polyalanine model[79 aa] A 100.0
/76.4		 1
/1		 AP3A_SARS2 ORF3a protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
274 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7kjr[10] E PEE
1,2-dioleoyl-sn-glycero-3-phosphoethanolamine[23 a.. 		A 75.0
/76.6		 4
/4		 AP3A_SARS2 ORF3a protein
7kjr[8] F PEE
1,2-dioleoyl-sn-glycero-3-phosphoethanolamine[23 a.. 		A 75.0
/76.6		 4
/4		 AP3A_SARS2 ORF3a protein
8eqj[6] D PEE
1,2-dioleoyl-sn-glycero-3-phosphoethanolamine[22 a.. 		A 85.7
/76.4		 7
/7		 AP3A_SARS2 ORF3a protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
274 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8eqs[2] B AP3A_SARS ORF3a protein[192 aa] A 100.0
/100.0		 48
/48		 AP3A_SARS ORF3a protein
6xdc[10] B AP3A_SARS2 ORF3a protein[193 aa] A 88.1
/76.6		 42
/42		 AP3A_SARS2 ORF3a protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.