HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[30 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

1682730

498

Q13568(IRF5_HUMAN)

RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ;

QUERYSEQ

MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEEL
QRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP
SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDL
KDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q13568(IRF5_HUMAN)]

498
	region	name	description
	1-498	CHAIN	/note="Interferon regulatory factor 5" /id="PRO_0000154558"
	14-122	DNA_BIND	/note="IRF tryptophan pentad repeat"
	121-207	REGION	/note="Disordered"
	478-498	REGION	/note="Disordered"
	169-206	COMPBIAS	/note="Pro residues"
	1-498	DISORDER	predicted by DISOPRED

MONOMER

498

pdb_id a¹ identity[%]² description

3dsh A 99.6 IRF5_HUMAN Interferon regulatory factor 5

7rh2 A 46.2 Q99419_HUMAN ICSAT transcription factor

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

498 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1t2k[1] F ATF2_HUMAN Cyclic-AMP-dependent transcription factor ATF-2[61.. C 33.3
/44.3 3
/3 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] B STING_HUMAN Stimulator of interferon genes protein[10 aa] D 46.7
/35.2 15
/15 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] C STING_HUMAN Stimulator of interferon genes protein[4 aa] D 0.0
/35.2 2
/2 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] C STING_HUMAN Stimulator of interferon genes protein[4 aa] E 60.0
/35.2 5
/5 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] A STING_HUMAN Stimulator of interferon genes protein[21 aa] E 40.0
/35.2 15
/15 IRF3_HUMAN Interferon regulatory factor 3

5jek[1] C MAVS peptide[14 aa] A 50.0
/35.2 12
/13 IRF3_HUMAN Interferon regulatory factor 3

5jek[1] D MAVS peptide[16 aa] B 36.4
/35.2 11
/12 IRF3_HUMAN Interferon regulatory factor 3

5jel[2] B Phosphorylated TRIF peptide[14 aa] A 37.5
/35.2 16
/16 IRF3_HUMAN Interferon regulatory factor 3

5jeo[2] A Rotavirus NSP1 peptide[10 aa] B 47.1
/35.2 17
/17 IRF3_HUMAN Interferon regulatory factor 3

5jer[4] A Rotavirus NSP1 peptide[10 aa] E 42.9
/35.2 14
/14 IRF3_HUMAN Interferon regulatory factor 3

5jer[1] D Rotavirus NSP1 peptide[10 aa] F 0.0
/35.2 1
/1 IRF3_HUMAN Interferon regulatory factor 3

1zoq[2] B CBP_HUMAN CREB-binding protein[47 aa] A 41.7
/35.7 12
/18 IRF3_HUMAN Interferon regulatory factor 3

5jem[7] B CBP_HUMAN CREB-binding protein[42 aa] A 43.8
/34.9 16
/18 IRF3_HUMAN Interferon regulatory factor 3

5jem[4] D CBP_HUMAN CREB-binding protein[42 aa] A 0.0
/34.9 3
/3 IRF3_HUMAN Interferon regulatory factor 3

7jfm[1] D CBP_HUMAN CREB-binding protein[37 aa] A 0.0
/34.2 1
/1 IRF3_MOUSE Interferon regulatory factor 3

7jfm[1] D CBP_HUMAN CREB-binding protein[37 aa] C 33.3
/34.9 15
/17 IRF3_MOUSE Interferon regulatory factor 3

5oen[1] B Q3UDU1_MOUSE Signal transducer and activator of transcription[1.. A 23.1
/33.6 13
/20 IRF9_MOUSE Interferon regulatory factor 9

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

498 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

8jkl[8] C GATA-Forward E 70.0
/48.0 10
/10 F2Z3D5_HUMAN Interferon regulatory factor 4

8jkl[8] D GATA-Reverse E 66.7
/48.0 9
/11 F2Z3D5_HUMAN Interferon regulatory factor 4

7jm4[8] A Interferon-Stimulated Response Elements C 70.0
/45.3 10
/10 IRF4_HUMAN Interferon regulatory factor 4

7jm4[6] B Interferon-Stimulated Response Elements C 55.6
/45.3 9
/9 IRF4_HUMAN Interferon regulatory factor 4

7rh2[2] F DNA (5'-D(*GP*CP*TP*TP*TP*CP*TP*CP*GP*GP*TP*TP*TP*.. G 70.0
/46.2 10
/11 Q99419_HUMAN ICSAT transcription factor

7o56[3] B DNA (5'-D(P*AP*AP*TP*AP*AP*AP*AP*GP*AP*AP*AP*CP*CP.. A 77.8
/45.0 9
/9 IRF4_HUMAN Interferon regulatory factor 4

7o56[2] C DNA (5'-D(P*TP*TP*TP*AP*CP*TP*TP*TP*CP*GP*GP*TP*TP.. A 58.3
/45.0 12
/13 IRF4_HUMAN Interferon regulatory factor 4

8jkn[4] A GAAA-Forward C 80.0
/45.3 10
/10 F2Z3D5_HUMAN Interferon regulatory factor 4

8jkn[4] B GAAA-Reverse C 50.0
/45.3 10
/12 F2Z3D5_HUMAN Interferon regulatory factor 4

8jkq[4] A GACA-Forward C 77.8
/44.8 9
/9 F2Z3D5_HUMAN Interferon regulatory factor 4

8jkq[4] B GACA-Reverse C 54.5
/44.8 11
/12 F2Z3D5_HUMAN Interferon regulatory factor 4

8jks[4] A GAGA-Forward C 75.0
/45.3 8
/8 F2Z3D5_HUMAN Interferon regulatory factor 4

8jks[4] B GAGA-Reverse C 54.5
/45.3 11
/13 F2Z3D5_HUMAN Interferon regulatory factor 4

2o61[1] A 36-MER C 45.5
/45.1 11
/34 TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..

2o61[1] B 34-MER C 38.5
/45.1 13
/36 TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..

2pi0[4] A PRDIII-I region of human interferon-B promoter str.. C 50.0
/46.9 12
/12 IRF3_HUMAN Interferon regulatory factor 3

2pi0[4] B PRDIII-I region of human interferon-B promoter str.. C 54.5
/46.9 11
/13 IRF3_HUMAN Interferon regulatory factor 3

7ogs[4] C DNA (5'-D(P*TP*GP*TP*AP*CP*TP*TP*TP*CP*GP*GP*TP*TP.. A 63.6
/45.0 11
/13 IRF4_HUMAN Interferon regulatory factor 4

7ogs[4] D DNA (5'-D(P*AP*TP*AP*AP*CP*TP*GP*AP*AP*AP*CP*CP*GP.. A 75.0
/45.0 12
/12 IRF4_HUMAN Interferon regulatory factor 4

7oot[2] C DNA (5'-D(P*TP*CP*AP*AP*CP*TP*GP*AP*AP*AP*CP*CP*GP.. A 81.8
/45.0 11
/11 IRF4_HUMAN Interferon regulatory factor 4

7oot[2] D DNA (5'-D(P*AP*GP*CP*TP*TP*TP*CP*TP*CP*GP*GP*TP*TP.. A 41.7
/45.0 12
/13 IRF4_HUMAN Interferon regulatory factor 4

1t2k[2] A 31-MER C 55.6
/44.3 9
/9 IRF3_HUMAN Interferon regulatory factor 3

1t2k[2] B 31-MER C 46.7
/44.3 15
/17 IRF3_HUMAN Interferon regulatory factor 3

2o6g[4] A interferon-b enhancer C 50.0
/44.3 12
/12 IRF3_HUMAN Interferon regulatory factor 3

2o6g[4] B interferon-b enhancer C 42.9
/44.3 14
/16 IRF3_HUMAN Interferon regulatory factor 3

2irf[4] F DNA (5'-D(*TP*TP*CP*AP*CP*TP*TP*TP*CP*AP*CP*(5IU)P.. G 70.0
/43.9 10
/10 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

2irf[3] A DNA (5'-D(P*AP*AP*GP*TP*GP*AP*AP*AP*GP*(5IU)P*GP*A.. H 63.6
/43.9 11
/11 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

2irf[2] E DNA (5'-D(*TP*TP*CP*AP*CP*TP*TP*TP*CP*AP*CP*(5IU)P.. I 70.0
/43.9 10
/10 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

1if1[2] A DNA (26-MER) C 68.2
/42.9 22
/22 IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)

1if1[2] B DNA (26-MER) C 50.0
/42.9 2
/2 IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

498 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3qu3[3] D NA
SODIUM ION[1 atoms] A 50.0
/41.5 4
/4 IRF7_MOUSE Interferon regulatory factor 7

3qu6[1] K NA
SODIUM ION[1 atoms] A 50.0
/45.8 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] L NA
SODIUM ION[1 atoms] A 40.0
/45.8 5
/5 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] D ZN
ZINC ION[1 atoms] A 0.0
/45.8 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[1] E ZN
ZINC ION[1 atoms] A 50.0
/45.8 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] F ZN
ZINC ION[1 atoms] A 50.0
/45.8 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[4] G ZN
ZINC ION[1 atoms] A 25.0
/45.8 4
/4 Q7Z5G6_HUMAN IRF3 protein

3qu6[4] H CL
CHLORIDE ION[1 atoms] A 25.0
/45.8 4
/4 Q7Z5G6_HUMAN IRF3 protein

3qu6[1] I CL
CHLORIDE ION[1 atoms] A 0.0
/45.8 1
/1 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] M CL
CHLORIDE ION[1 atoms] A 25.0
/45.8 4
/4 Q7Z5G6_HUMAN IRF3 protein

5bvi[2] C CL
CHLORIDE ION[1 atoms] A 66.7
/42.1 6
/6 Q5SUZ4_MOUSE Interferon regulatory factor 4

5bvi[1] D CL
CHLORIDE ION[1 atoms] A 16.7
/42.1 6
/6 Q5SUZ4_MOUSE Interferon regulatory factor 4

5bvi[1] E CL
CHLORIDE ION[1 atoms] A 50.0
/42.1 2
/2 Q5SUZ4_MOUSE Interferon regulatory factor 4

6td4[1] B CL
CHLORIDE ION[1 atoms] A 0.0
/44.7 1
/1 IRF4_HUMAN Interferon regulatory factor 4

2irf[6] M K
POTASSIUM ION[1 atoms] G 25.0
/43.9 4
/4 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

498 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3dsh[2] A IRF5_HUMAN Interferon regulatory factor 5[236 aa] A 98.4
/99.6 62
/62 IRF5_HUMAN Interferon regulatory factor 5

7o56[1] E IRF4_HUMAN Interferon regulatory factor 4[112 aa] D 50.0
/45.3 2
/2 IRF4_HUMAN Interferon regulatory factor 4

7o56[1] D IRF4_HUMAN Interferon regulatory factor 4[109 aa] E 0.0
/45.3 2
/2 IRF4_HUMAN Interferon regulatory factor 4

2o6g[3] E IRF3_HUMAN Interferon regulatory factor 3[110 aa] C 66.7
/44.3 3
/3 IRF3_HUMAN Interferon regulatory factor 3

2o6g[2] C IRF3_HUMAN Interferon regulatory factor 3[110 aa] E 0.0
/44.3 3
/3 IRF3_HUMAN Interferon regulatory factor 3

2pi0[1] C IRF3_HUMAN Interferon regulatory factor 3[98 aa] E 0.0
/45.2 1
/1 IRF3_HUMAN Interferon regulatory factor 3

1qwt[5] B IRF3_HUMAN Interferon regulatory factor 3[239 aa] A 12.5
/35.2 8
/9 IRF3_HUMAN Interferon regulatory factor 3

1qwt[1] A IRF3_HUMAN Interferon regulatory factor 3[239 aa] B 30.0
/35.2 10
/10 IRF3_HUMAN Interferon regulatory factor 3

5jej[16] E IRF3_HUMAN Interferon regulatory factor 3[233 aa] D 20.0
/35.2 20
/20 IRF3_HUMAN Interferon regulatory factor 3

7jfm[2] C IRF3_MOUSE Interferon regulatory factor 3[194 aa] A 40.5
/34.2 37
/38 IRF3_MOUSE Interferon regulatory factor 3

5oem[2] A IRF9_MOUSE Interferon regulatory factor 9[189 aa] A 9.1
/34.5 11
/15 IRF9_MOUSE Interferon regulatory factor 9

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

498 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1qwt[2] C PO4
PHOSPHATE ION[5 atoms] A 0.0
/35.2 4
/4 IRF3_HUMAN Interferon regulatory factor 3

1qwt[2] D PO4
PHOSPHATE ION[5 atoms] A 0.0
/35.2 3
/6 IRF3_HUMAN Interferon regulatory factor 3

1qwt[2] E PO4
PHOSPHATE ION[5 atoms] A 0.0
/35.2 3
/3 IRF3_HUMAN Interferon regulatory factor 3

1qwt[1] I PO4
PHOSPHATE ION[5 atoms] B 0.0
/35.2 3
/4 IRF3_HUMAN Interferon regulatory factor 3

1qwt[1] J PO4
PHOSPHATE ION[5 atoms] B 66.7
/35.2 3
/4 IRF3_HUMAN Interferon regulatory factor 3

5jeo[4] C PO4
PHOSPHATE ION[5 atoms] B 25.0
/35.2 4
/4 IRF3_HUMAN Interferon regulatory factor 3

5jeo[4] D PO4
PHOSPHATE ION[5 atoms] B 66.7
/35.2 3
/3 IRF3_HUMAN Interferon regulatory factor 3

5jeo[2] E PO4
PHOSPHATE ION[5 atoms] B 50.0
/35.2 2
/2 IRF3_HUMAN Interferon regulatory factor 3

5oem[2] B PO4
PHOSPHATE ION[5 atoms] A 0.0
/34.5 5
/5 IRF9_MOUSE Interferon regulatory factor 9

7oot[1] E PO4
PHOSPHATE ION[5 atoms] B 0.0
/45.0 2
/2 IRF4_HUMAN Interferon regulatory factor 4

3qu3[1] F EDO
1,2-ETHANEDIOL[4 atoms] B 50.0
/41.9 2
/2 IRF7_MOUSE Interferon regulatory factor 7

3qu3[2] G EDO
1,2-ETHANEDIOL[4 atoms] B 33.3
/41.9 3
/3 IRF7_MOUSE Interferon regulatory factor 7

3qu3[1] J EDO
1,2-ETHANEDIOL[4 atoms] C 66.7
/41.5 3
/5 IRF7_MOUSE Interferon regulatory factor 7

3a77[2] E ACY
ACETIC ACID[4 atoms] A 25.0
/36.7 4
/5 IRF3_HUMAN Interferon regulatory factor 3

3a77[4] F MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] A 0.0
/36.7 5
/5 IRF3_HUMAN Interferon regulatory factor 3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
498
	pdb_id	a¹	identity[%]²	description
	3dsh	A	99.6	IRF5_HUMAN Interferon regulatory factor 5
	7rh2	A	46.2	Q99419_HUMAN ICSAT transcription factor
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
498	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1t2k[1]	F	ATF2_HUMAN Cyclic-AMP-dependent transcription factor ATF-2[61..	C	33.3 /44.3	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	B	STING_HUMAN Stimulator of interferon genes protein[10 aa]	D	46.7 /35.2	15 /15	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	C	STING_HUMAN Stimulator of interferon genes protein[4 aa]	D	0.0 /35.2	2 /2	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	C	STING_HUMAN Stimulator of interferon genes protein[4 aa]	E	60.0 /35.2	5 /5	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	A	STING_HUMAN Stimulator of interferon genes protein[21 aa]	E	40.0 /35.2	15 /15	IRF3_HUMAN Interferon regulatory factor 3
	5jek[1]	C	MAVS peptide[14 aa]	A	50.0 /35.2	12 /13	IRF3_HUMAN Interferon regulatory factor 3
	5jek[1]	D	MAVS peptide[16 aa]	B	36.4 /35.2	11 /12	IRF3_HUMAN Interferon regulatory factor 3
	5jel[2]	B	Phosphorylated TRIF peptide[14 aa]	A	37.5 /35.2	16 /16	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[2]	A	Rotavirus NSP1 peptide[10 aa]	B	47.1 /35.2	17 /17	IRF3_HUMAN Interferon regulatory factor 3
	5jer[4]	A	Rotavirus NSP1 peptide[10 aa]	E	42.9 /35.2	14 /14	IRF3_HUMAN Interferon regulatory factor 3
	5jer[1]	D	Rotavirus NSP1 peptide[10 aa]	F	0.0 /35.2	1 /1	IRF3_HUMAN Interferon regulatory factor 3
	1zoq[2]	B	CBP_HUMAN CREB-binding protein[47 aa]	A	41.7 /35.7	12 /18	IRF3_HUMAN Interferon regulatory factor 3
	5jem[7]	B	CBP_HUMAN CREB-binding protein[42 aa]	A	43.8 /34.9	16 /18	IRF3_HUMAN Interferon regulatory factor 3
	5jem[4]	D	CBP_HUMAN CREB-binding protein[42 aa]	A	0.0 /34.9	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	7jfm[1]	D	CBP_HUMAN CREB-binding protein[37 aa]	A	0.0 /34.2	1 /1	IRF3_MOUSE Interferon regulatory factor 3
	7jfm[1]	D	CBP_HUMAN CREB-binding protein[37 aa]	C	33.3 /34.9	15 /17	IRF3_MOUSE Interferon regulatory factor 3
	5oen[1]	B	Q3UDU1_MOUSE Signal transducer and activator of transcription[1..	A	23.1 /33.6	13 /20	IRF9_MOUSE Interferon regulatory factor 9
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
498	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	8jkl[8]	C	GATA-Forward	E	70.0 /48.0	10 /10	F2Z3D5_HUMAN Interferon regulatory factor 4
	8jkl[8]	D	GATA-Reverse	E	66.7 /48.0	9 /11	F2Z3D5_HUMAN Interferon regulatory factor 4
	7jm4[8]	A	Interferon-Stimulated Response Elements	C	70.0 /45.3	10 /10	IRF4_HUMAN Interferon regulatory factor 4
	7jm4[6]	B	Interferon-Stimulated Response Elements	C	55.6 /45.3	9 /9	IRF4_HUMAN Interferon regulatory factor 4
	7rh2[2]	F	DNA (5'-D(GPCPTPTPTPCPTPCPGPGPTPTPTP..	G	70.0 /46.2	10 /11	Q99419_HUMAN ICSAT transcription factor
	7o56[3]	B	DNA (5'-D(PAPAPTPAPAPAPAPGPAPAPAPCP*CP..	A	77.8 /45.0	9 /9	IRF4_HUMAN Interferon regulatory factor 4
	7o56[2]	C	DNA (5'-D(PTPTPTPAPCPTPTPTPCPGPGPTP*TP..	A	58.3 /45.0	12 /13	IRF4_HUMAN Interferon regulatory factor 4
	8jkn[4]	A	GAAA-Forward	C	80.0 /45.3	10 /10	F2Z3D5_HUMAN Interferon regulatory factor 4
	8jkn[4]	B	GAAA-Reverse	C	50.0 /45.3	10 /12	F2Z3D5_HUMAN Interferon regulatory factor 4
	8jkq[4]	A	GACA-Forward	C	77.8 /44.8	9 /9	F2Z3D5_HUMAN Interferon regulatory factor 4
	8jkq[4]	B	GACA-Reverse	C	54.5 /44.8	11 /12	F2Z3D5_HUMAN Interferon regulatory factor 4
	8jks[4]	A	GAGA-Forward	C	75.0 /45.3	8 /8	F2Z3D5_HUMAN Interferon regulatory factor 4
	8jks[4]	B	GAGA-Reverse	C	54.5 /45.3	11 /13	F2Z3D5_HUMAN Interferon regulatory factor 4
	2o61[1]	A	36-MER	C	45.5 /45.1	11 /34	TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..
	2o61[1]	B	34-MER	C	38.5 /45.1	13 /36	TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..
	2pi0[4]	A	PRDIII-I region of human interferon-B promoter str..	C	50.0 /46.9	12 /12	IRF3_HUMAN Interferon regulatory factor 3
	2pi0[4]	B	PRDIII-I region of human interferon-B promoter str..	C	54.5 /46.9	11 /13	IRF3_HUMAN Interferon regulatory factor 3
	7ogs[4]	C	DNA (5'-D(PTPGPTPAPCPTPTPTPCPGPGPTP*TP..	A	63.6 /45.0	11 /13	IRF4_HUMAN Interferon regulatory factor 4
	7ogs[4]	D	DNA (5'-D(PAPTPAPAPCPTPGPAPAPAPCPCP*GP..	A	75.0 /45.0	12 /12	IRF4_HUMAN Interferon regulatory factor 4
	7oot[2]	C	DNA (5'-D(PTPCPAPAPCPTPGPAPAPAPCPCP*GP..	A	81.8 /45.0	11 /11	IRF4_HUMAN Interferon regulatory factor 4
	7oot[2]	D	DNA (5'-D(PAPGPCPTPTPTPCPTPCPGPGPTP*TP..	A	41.7 /45.0	12 /13	IRF4_HUMAN Interferon regulatory factor 4
	1t2k[2]	A	31-MER	C	55.6 /44.3	9 /9	IRF3_HUMAN Interferon regulatory factor 3
	1t2k[2]	B	31-MER	C	46.7 /44.3	15 /17	IRF3_HUMAN Interferon regulatory factor 3
	2o6g[4]	A	interferon-b enhancer	C	50.0 /44.3	12 /12	IRF3_HUMAN Interferon regulatory factor 3
	2o6g[4]	B	interferon-b enhancer	C	42.9 /44.3	14 /16	IRF3_HUMAN Interferon regulatory factor 3
	2irf[4]	F	DNA (5'-D(TPTPCPAPCPTPTPTPCPAPCP(5IU)P..	G	70.0 /43.9	10 /10	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	2irf[3]	A	DNA (5'-D(PAPAPGPTPGPAPAPAPGP(5IU)PGPA..	H	63.6 /43.9	11 /11	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	2irf[2]	E	DNA (5'-D(TPTPCPAPCPTPTPTPCPAPCP(5IU)P..	I	70.0 /43.9	10 /10	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	1if1[2]	A	DNA (26-MER)	C	68.2 /42.9	22 /22	IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)
	1if1[2]	B	DNA (26-MER)	C	50.0 /42.9	2 /2	IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
498	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3qu3[3]	D	NA SODIUM ION[1 atoms]	A	50.0 /41.5	4 /4	IRF7_MOUSE Interferon regulatory factor 7
	3qu6[1]	K	NA SODIUM ION[1 atoms]	A	50.0 /45.8	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	L	NA SODIUM ION[1 atoms]	A	40.0 /45.8	5 /5	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	D	ZN ZINC ION[1 atoms]	A	0.0 /45.8	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[1]	E	ZN ZINC ION[1 atoms]	A	50.0 /45.8	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	F	ZN ZINC ION[1 atoms]	A	50.0 /45.8	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[4]	G	ZN ZINC ION[1 atoms]	A	25.0 /45.8	4 /4	Q7Z5G6_HUMAN IRF3 protein
	3qu6[4]	H	CL CHLORIDE ION[1 atoms]	A	25.0 /45.8	4 /4	Q7Z5G6_HUMAN IRF3 protein
	3qu6[1]	I	CL CHLORIDE ION[1 atoms]	A	0.0 /45.8	1 /1	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	M	CL CHLORIDE ION[1 atoms]	A	25.0 /45.8	4 /4	Q7Z5G6_HUMAN IRF3 protein
	5bvi[2]	C	CL CHLORIDE ION[1 atoms]	A	66.7 /42.1	6 /6	Q5SUZ4_MOUSE Interferon regulatory factor 4
	5bvi[1]	D	CL CHLORIDE ION[1 atoms]	A	16.7 /42.1	6 /6	Q5SUZ4_MOUSE Interferon regulatory factor 4
	5bvi[1]	E	CL CHLORIDE ION[1 atoms]	A	50.0 /42.1	2 /2	Q5SUZ4_MOUSE Interferon regulatory factor 4
	6td4[1]	B	CL CHLORIDE ION[1 atoms]	A	0.0 /44.7	1 /1	IRF4_HUMAN Interferon regulatory factor 4
	2irf[6]	M	K POTASSIUM ION[1 atoms]	G	25.0 /43.9	4 /4	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
498	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3dsh[2]	A	IRF5_HUMAN Interferon regulatory factor 5[236 aa]	A	98.4 /99.6	62 /62	IRF5_HUMAN Interferon regulatory factor 5
	7o56[1]	E	IRF4_HUMAN Interferon regulatory factor 4[112 aa]	D	50.0 /45.3	2 /2	IRF4_HUMAN Interferon regulatory factor 4
	7o56[1]	D	IRF4_HUMAN Interferon regulatory factor 4[109 aa]	E	0.0 /45.3	2 /2	IRF4_HUMAN Interferon regulatory factor 4
	2o6g[3]	E	IRF3_HUMAN Interferon regulatory factor 3[110 aa]	C	66.7 /44.3	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	2o6g[2]	C	IRF3_HUMAN Interferon regulatory factor 3[110 aa]	E	0.0 /44.3	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	2pi0[1]	C	IRF3_HUMAN Interferon regulatory factor 3[98 aa]	E	0.0 /45.2	1 /1	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[5]	B	IRF3_HUMAN Interferon regulatory factor 3[239 aa]	A	12.5 /35.2	8 /9	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[1]	A	IRF3_HUMAN Interferon regulatory factor 3[239 aa]	B	30.0 /35.2	10 /10	IRF3_HUMAN Interferon regulatory factor 3
	5jej[16]	E	IRF3_HUMAN Interferon regulatory factor 3[233 aa]	D	20.0 /35.2	20 /20	IRF3_HUMAN Interferon regulatory factor 3
	7jfm[2]	C	IRF3_MOUSE Interferon regulatory factor 3[194 aa]	A	40.5 /34.2	37 /38	IRF3_MOUSE Interferon regulatory factor 3
	5oem[2]	A	IRF9_MOUSE Interferon regulatory factor 9[189 aa]	A	9.1 /34.5	11 /15	IRF9_MOUSE Interferon regulatory factor 9
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
498	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1qwt[2]	C	PO4 PHOSPHATE ION[5 atoms]	A	0.0 /35.2	4 /4	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[2]	D	PO4 PHOSPHATE ION[5 atoms]	A	0.0 /35.2	3 /6	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[2]	E	PO4 PHOSPHATE ION[5 atoms]	A	0.0 /35.2	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[1]	I	PO4 PHOSPHATE ION[5 atoms]	B	0.0 /35.2	3 /4	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[1]	J	PO4 PHOSPHATE ION[5 atoms]	B	66.7 /35.2	3 /4	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[4]	C	PO4 PHOSPHATE ION[5 atoms]	B	25.0 /35.2	4 /4	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[4]	D	PO4 PHOSPHATE ION[5 atoms]	B	66.7 /35.2	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[2]	E	PO4 PHOSPHATE ION[5 atoms]	B	50.0 /35.2	2 /2	IRF3_HUMAN Interferon regulatory factor 3
	5oem[2]	B	PO4 PHOSPHATE ION[5 atoms]	A	0.0 /34.5	5 /5	IRF9_MOUSE Interferon regulatory factor 9
	7oot[1]	E	PO4 PHOSPHATE ION[5 atoms]	B	0.0 /45.0	2 /2	IRF4_HUMAN Interferon regulatory factor 4
	3qu3[1]	F	EDO 1,2-ETHANEDIOL[4 atoms]	B	50.0 /41.9	2 /2	IRF7_MOUSE Interferon regulatory factor 7
	3qu3[2]	G	EDO 1,2-ETHANEDIOL[4 atoms]	B	33.3 /41.9	3 /3	IRF7_MOUSE Interferon regulatory factor 7
	3qu3[1]	J	EDO 1,2-ETHANEDIOL[4 atoms]	C	66.7 /41.5	3 /5	IRF7_MOUSE Interferon regulatory factor 7
	3a77[2]	E	ACY ACETIC ACID[4 atoms]	A	25.0 /36.7	4 /5	IRF3_HUMAN Interferon regulatory factor 3
	3a77[4]	F	MPD (4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]	A	0.0 /36.7	5 /5	IRF3_HUMAN Interferon regulatory factor 3
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[30 %]

UniProt Feature Tables [Q13568(IRF5_HUMAN)]