Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[100 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1766661 98 0 P59636(ORF9B_SARS) RecName: Full=ORF9b protein;AltName: Full=Accessory protein 9b;AltName: Full=ORF-9b;AltName: Full=Protein 9b;
QUERYSEQ
MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59636(ORF9B_SARS)]

98
region name description
1-98 CHAIN /note="ORF9b protein" /id="PRO_0000106137"
9-98 DOMAIN /note="9b"
1-4 DISORDER predicted by DISOPRED

No homologue is found in PDB.

Please check [SiteTable] for homologues.