Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1697459 | 419 | 12 | Q9Y6K9(NEMO_HUMAN) | RecName: Full=NF-kappa-B essential modulator ; Short=NEMO ;AltName: Full=FIP-3;AltName: Full=IkB kinase-associated protein 1; Short=IKKAP1;AltName: Full=Inhibitor of nuclear factor kappa-B kinase subunit gamma; Short=I-kappa-B kinase subunit gamma; Short=IKK-gamma; Short=IKKG; Short=IkB kinase subunit gamma;AltName: Full=NF-kappa-B essential modifier; |
QUERYSEQ |
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLL GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE |
419 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() |
1-419 | CHAIN | /note="NF-kappa-B essential modulator" /id="PRO_0000096782" |
![]() ![]() |
389-419 | ZN_FING | /note="CCHC NOA-type" |
![]() ![]() |
1-197 | REGION | /note="Required for interaction with and ubiquitination by MARCHF2" |
![]() ![]() ![]() |
44-111 | REGION | /note="Interaction with CHUK/IKBKB" |
![]() ![]() ![]() |
150-257 | REGION | /note="Interaction with TANK" |
![]() ![]() ![]() |
242-350 | REGION | /note="Ubiquitin-binding (UBAN)" |
![]() ![]() ![]() |
246-365 | REGION | /note="Self-association" |
![]() ![]() |
251-419 | REGION | /note="Required for interaction with TNFAIP3" |
![]() ![]() ![]() |
322-343 | REGION | /note="Leucine-zipper" |
![]() ![]() ![]() |
358-395 | REGION | /note="Disordered" |
![]() ![]() |
382-419 | REGION | /note="Interaction with CYLD" |
![]() ![]() ![]() |
49-356 | COILED | |
![]() ![]() ![]() |
397-397 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" |
![]() ![]() ![]() |
400-400 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" |
![]() ![]() ![]() |
413-413 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" |
![]() ![]() ![]() |
417-417 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
1-392 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
419 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | NEMO_HUMAN NF-kappa-B essential modulator | |||
![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | NEMO_HUMAN NF-kappa-B essential modulator | |||
![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | NEMO_HUMAN NF-kappa-B essential modulator | |||
![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | NEMO_HUMAN NF-KAPPA-B ESSENTIAL MODULATOR | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
419 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | IKKB_HUMAN IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit.. | B | 100.0 /100.0 |
16 /16 |
NEMO_HUMAN NF-kappa-B essential modulator |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | IKKB_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit.. | B | 100.0 /100.0 |
19 /19 |
NEMO_HUMAN NF-kappa-B essential modulator |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | P88961_HHV8 ORF K13[172 aa] | C | 100.0 /100.0 |
9 /9 |
NEMO_HUMAN NF-kappa-B essential modulator |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | P88961_HHV8 ORF K13[165 aa] | C | 100.0 /100.0 |
4 /4 |
NEMO_HUMAN NF-kappa-B essential modulator |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | UBC_HUMAN Polyubiquitin-C[147 aa] | A | 100.0 /100.0 |
7 /7 |
NEMO_HUMAN NF-kappa-B essential modulator |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | UBC_HUMAN Polyubiquitin-C[152 aa] | A | 100.0 /100.0 |
12 /12 |
NEMO_HUMAN NF-kappa-B essential modulator |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNF31_HUMAN E3 ubiquitin-protein ligase RNF31[27 aa] | A | 100.0 /100.0 |
3 /3 |
NEMO_HUMAN NF-kappa-B essential modulator |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | RNF31_HUMAN E3 ubiquitin-protein ligase RNF31[27 aa] | C | 100.0 /100.0 |
5 /5 |
NEMO_HUMAN NF-kappa-B essential modulator |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
419 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
ZN
|
A | 100.0 /100.0 |
4 /4 |
NEMO_HUMAN NF-kappa-B essential modulator |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
ZN
|
A | 100.0 /100.0 |
5 /5 |
NEMO_HUMAN NF-KAPPA-B ESSENTIAL MODULATOR |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
419 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | NEMO_HUMAN NF-kappa-B essential modulator[62 aa] | B | 100.0 /100.0 |
15 /15 |
NEMO_HUMAN NF-kappa-B essential modulator |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | NEMO_HUMAN NF-kappa-B essential modulator[62 aa] | B | 100.0 /100.0 |
16 /16 |
NEMO_HUMAN NF-kappa-B essential modulator |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | NEMO_HUMAN NF-kappa-B essential modulator[58 aa] | C | 100.0 /100.0 |
17 /17 |
NEMO_HUMAN NF-kappa-B essential modulator |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NEMO_HUMAN NF-kappa-B essential modulator[71 aa] | A | 100.0 /100.0 |
25 /25 |
NEMO_HUMAN NF-kappa-B essential modulator |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |