#WARNING:no index is registered index "YP_009724395.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724395.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins


[Summary Bars]

[SiteTable]


Full Bars[90 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
22162 121 3 YP_009724395.1()
QUERYSEQ
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009724395.1()]

121
region name description
1-121 DISORDER predicted by DISOPRED

MONOMER
121
pdb_id a1 identity[%]2 description
1yo4 A 91.6 YX4_CVHSA Hypothetical protein X4
7ci3 A 100.0 A0A6C0X2S1_SARS2 Orf7a protein
6w37 A 100.0 NS7A_SARS2 ORF7a protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.