HOMCOS(prot_sch_conbars.cgi):

#WARNING:no index is registered index "YP_009725304.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725304.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

		Contact Molecules for Homologous Proteins
[Summary Bars]	[SiteTable]	Full Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
1118177	198	151	YP_009725304.1()
QUERYSEQ	AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYA SALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725304.1()]

198
	region	name	description
	1-198	DISORDER	predicted by DISOPRED

MONOMER

198

pdb_id a¹ identity[%]² description

7uo9 B 100.0 R1AB_SARS2 Non-structural protein 8

8gwe B 100.0 R1AB_SARS2 Non-structural protein 8

7uoe B 100.0 R1AB_SARS2 Non-structural protein 8

8gwf D 100.0 R1AB_SARS2 Non-structural protein 8

8gwi B 100.0 R1AB_SARS2 Non-structural protein 8

8gwg D 100.0 R1AB_SARS2 Non-structural protein 8

8gwg B 100.0 R1AB_SARS2 Non-structural protein 8

7uob B 100.0 R1AB_SARS2 Non-structural protein 8

8gwo B 100.0 R1AB_SARS2 Non-structural protein 8

7uo4 D 100.0 R1AB_SARS2 Non-structural protein 8

8sqk B 100.0 R1AB_SARS2 Non-structural protein 8

8gwe D 100.0 R1AB_SARS2 Non-structural protein 8

7cxm B 100.0 R1AB_SARS2 Non-structural protein 8

8gwn B 100.0 R1AB_SARS2 Non-structural protein 8

7cyq B 100.0 R1AB_SARS2 Non-structural protein 8

7cxn B 100.0 R1AB_SARS2 Non-structural protein 8

8sqj B 100.0 R1AB_SARS2 Non-structural protein 8

8gwk B 100.0 R1AB_SARS2 Non-structural protein 8

8gwi D 100.0 R1AB_SARS2 Non-structural protein 8

8gw1 B 100.0 R1AB_SARS2 Non-structural protein 8

7egq J 100.0 R1AB_SARS2 Non-structural protein 8

7egq B 100.0 R1AB_SARS2 Non-structural protein 8

8gwm B 100.0 R1AB_SARS2 Non-structural protein 8

8gwb B 100.0 R1AB_SARS2 Non-structural protein 8

7uo4 B 100.0 R1AB_SARS2 Non-structural protein 8

7eiz B 100.0 R1AB_SARS2 Non-structural protein 8

8gwf B 100.0 R1AB_SARS2 Non-structural protein 8

7dte B 100.0 R1AB_SARS2 Non-structural protein 8

2ahm H 97.4 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm G 97.4 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

7uoe D 100.0 R1AB_SARS2 Non-structural protein 8

7uob D 100.0 R1AB_SARS2 Non-structural protein 8

7uo9 F 100.0 R1AB_SARS2 Non-structural protein 8

7uo7 F 100.0 R1AB_SARS2 Non-structural protein 8

7uo7 B 100.0 R1AB_SARS2 Non-structural protein 8

7eiz D 100.0 R1AB_SARS2 Non-structural protein 8

8sq9 D 100.0 R1AB_SARS2 Non-structural protein 8

7cxm D 100.0 R1AB_SARS2 Non-structural protein 8

8gwo D 100.0 R1AB_SARS2 Non-structural protein 8

8gwn D 100.0 R1AB_SARS2 Non-structural protein 8

8gw1 D 100.0 R1AB_SARS2 Non-structural protein 8

7cyq D 100.0 R1AB_SARS2 Non-structural protein 8

7cxn D 100.0 R1AB_SARS2 Non-structural protein 8

8sq9 B 100.0 R1AB_SARS2 Non-structural protein 8

8gwb D 100.0 R1AB_SARS2 Non-structural protein 8

7egq L 100.0 R1AB_SARS2 Non-structural protein 8

7egq D 100.0 R1AB_SARS2 Non-structural protein 8

8gwk D 100.0 R1AB_SARS2 Non-structural protein 8

8gwm D 100.0 R1AB_SARS2 Non-structural protein 8

7re3 G 100.0 R1AB_SARS2 Non-structural protein 8

6xez D 100.0 R1AB_SARS2 Non-structural protein 8

7re1 B 100.0 R1AB_SARS2 Non-structural protein 8

7re3 B 100.0 R1AB_SARS2 Non-structural protein 8

7re2 B 100.0 R1AB_SARS2 Non-structural protein 8

7kro B 100.0 R1AB_SARS2 Non-structural protein 8

7krp B 100.0 R1AB_SARS2 Non-structural protein 8

7re0 B 100.0 R1AB_SARS2 Non-structural protein 8

7rdz B 100.0 R1AB_SARS2 Non-structural protein 8

7rdy B 100.0 R1AB_SARS2 Non-structural protein 8

7rdx B 100.0 R1AB_SARS2 Non-structural protein 8

6xez B 100.0 R1AB_SARS2 Non-structural protein 8

7krn B 100.0 R1AB_SARS2 Non-structural protein 8

7dte D 100.0 R1AB_SARS2 Non-structural protein 8

6yyt D 100.0 R1AB_SARS2 nsp8

6yyt B 100.0 R1AB_SARS2 nsp8

8sqj D 100.0 R1AB_SARS2 Non-structural protein 8

8sqk D 100.0 R1AB_SARS2 Non-structural protein 8

7krn D 100.0 R1AB_SARS2 Non-structural protein 8

7re2 D 100.0 R1AB_SARS2 Non-structural protein 8

7re1 D 100.0 R1AB_SARS2 Non-structural protein 8

7re0 D 100.0 R1AB_SARS2 Non-structural protein 8

7re3 L 100.0 R1AB_SARS2 Non-structural protein 8

7re3 D 100.0 R1AB_SARS2 Non-structural protein 8

7rdy D 100.0 R1AB_SARS2 Non-structural protein 8

7rdz D 100.0 R1AB_SARS2 Non-structural protein 8

7rdx D 100.0 R1AB_SARS2 Non-structural protein 8

7krp D 100.0 R1AB_SARS2 Non-structural protein 8

7kro D 100.0 R1AB_SARS2 Non-structural protein 8

7dok F 100.0 R1AB_SARS2 Non-structural protein 8

7dok D 100.0 R1AB_SARS2 Non-structural protein 8

7ed5 D 100.0 R1AB_SARS2 Non-structural protein 8

2ahm E 97.4 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

7ed5 B 100.0 R1AB_SARS2 Non-structural protein 8

2ahm F 97.2 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

7c2k D 100.0 R1AB_SARS2 Non-structural protein 8

7btf C 100.0 R1AB_SARS2 Non-structural protein 8

6wqd B 100.0 R1AB_SARS2 Non-structural protein 8

6yhu B 100.0 R1A_SARS2 Replicase polyprotein 1a

6xip D 100.0 R1AB_SARS2 Non-structural protein 8

7dcd D 100.0 R1A_SARS2 Non-structural protein 8

7dcd B 100.0 R1A_SARS2 Non-structural protein 8

6yhu D 100.0 R1A_SARS2 Replicase polyprotein 1a

6wtc D 100.0 R1AB_SARS2 Non-structural protein 8

7dfg D 100.0 R1AB_SARS2 Non-structural protein 8

6wtc B 100.0 R1AB_SARS2 Non-structural protein 8

7jlt D 100.0 R1AB_SARS2 Non-structural protein 8

7c2k B 100.0 R1AB_SARS2 Non-structural protein 8

6wiq B 100.0 R1AB_SARS2 Non-structural protein 8

6xip B 100.0 R1AB_SARS2 Non-structural protein 8

7jlt B 100.0 R1AB_SARS2 Non-structural protein 8

7dcd H 100.0 R1A_SARS2 Non-structural protein 8

7l1f B 100.0 R1AB_SARS2 Non-structural protein 8

6wqd D 100.0 R1AB_SARS2 Non-structural protein 8

6m5i A 100.0 R1A_SARS2 Non-structural protein 8

7b3d B 100.0 R1AB_SARS2 SARS-CoV-2 nsp8

7b3c B 100.0 R1AB_SARS2 Non-structural protein 8

7b3b B 100.0 R1AB_SARS2 Non-structural protein 8

7bw4 B 100.0 R1AB_SARS2 Non-structural protein 8

7ozv B 100.0 R1AB_SARS2 Non-structural protein 8

7ozu B 100.0 R1AB_SARS2 Non-structural protein 8

7dcd F 100.0 R1A_SARS2 Non-structural protein 8

7ctt B 100.0 R1AB_SARS2 Non-structural protein 8

7aap B 100.0 R1AB_SARS2 Non-structural protein 8

7doi B 100.0 R1AB_SARS2 Non-structural protein 8

7d4f A 100.0 R1AB_SARS2 Non-structural protein 8

7dfh B 100.0 R1AB_SARS2 Non-structural protein 8

7bzf B 100.0 R1AB_SARS2 Non-structural protein 8

7bv2 B 100.0 R1AB_SARS2 Non-structural protein 8

7bv1 B 100.0 R1AB_SARS2 Non-structural protein 8

6xqb B 100.0 R1AB_SARS2 Non-structural protein 8

5f22 B 96.5 R1AB_CVHSA Non-structural protein

8gy6 B 100.0 R1AB_SARS2 Non-structural protein 8

6m71 D 100.0 R1AB_SARS2 Non-structural protein 8

6nur B 96.5 R1A_CVHSA NSP8

6nus B 96.4 R1A_CVHSA NSP8

7thm B 100.0 R1AB_SARS2 Non-structural protein 8

7doi F 100.0 R1AB_SARS2 Non-structural protein 8

7d4f C 100.0 R1AB_SARS2 Non-structural protein 8

7dfg F 100.0 R1AB_SARS2 Non-structural protein 8

7dfh D 100.0 R1AB_SARS2 Non-structural protein 8

6nur D 96.3 R1A_CVHSA NSP8

7bzf D 100.0 R1AB_SARS2 Non-structural protein 8

7btf D 100.0 R1AB_SARS2 Non-structural protein 8

7bv1 D 100.0 R1AB_SARS2 Non-structural protein 8

8urb B 44.0 U6BRU0_9ALPC nsp8

7bw4 D 100.0 R1AB_SARS2 Non-structural protein 8

7oyg B 100.0 R1AB_SARS2 SARS-CoV-2 nsp8

7oyg G 100.0 R1AB_SARS2 SARS-CoV-2 nsp8

8urb D 43.3 U6BRU0_9ALPC nsp8

7ywr A 100.0 A0A8A0A7W8_SARS2 ORF1a polyprotein

3ub0 D 43.2 R1AB_FIPV Non-structural protein 6, nsp6,

3ub0 A 42.7 R1AB_FIPV Non-structural protein 6, nsp6,

9cpo D 44.0 R1AB_IBVM Non-structural protein 8

9cpo B 44.0 R1AB_IBVM Non-structural protein 8

7thm D 100.0 R1AB_SARS2 Non-structural protein 8

8g6r B 38.4 A0A1Z2R8Q6_9ALPC nsp8

6m71 C 100.0 R1AB_SARS2 Non-structural protein 8

8gy6 D 100.0 R1AB_SARS2 Non-structural protein 8

6xqb D 100.0 R1AB_SARS2 Non-structural protein 8

7ctt D 100.0 R1AB_SARS2 Non-structural protein 8

7aap D 100.0 R1AB_SARS2 Non-structural protein 8

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

198 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] E 100.0
/97.4 24
/24 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] E 100.0
/97.4 5
/5 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] E 100.0
/97.4 5
/5 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] E 100.0
/97.4 24
/24 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] E 100.0
/97.4 10
/10 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] E 100.0
/97.4 10
/10 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] F 100.0
/97.2 24
/24 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] F 100.0
/97.2 3
/3 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] F 100.0
/97.2 3
/3 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] F 100.0
/97.2 24
/24 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] F 100.0
/97.2 6
/6 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] F 100.0
/97.2 6
/6 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] G 100.0
/97.4 3
/3 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] G 100.0
/97.4 3
/3 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] G 100.0
/97.4 7
/7 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] G 100.0
/97.4 7
/7 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] G 100.0
/97.4 22
/22 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] G 100.0
/97.4 22
/22 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] G 100.0
/97.4 8
/8 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] G 100.0
/97.4 8
/8 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/97.4 8
/8 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/97.4 8
/8 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/97.4 3
/3 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm B R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] H 100.0
/97.4 3
/3 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] H 100.0
/97.4 10
/10 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm C R1AB_CVHSA Replicase polyprotein 1ab, light chain[74 aa] H 100.0
/97.4 10
/10 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] H 100.0
/97.4 25
/25 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] H 100.0
/97.4 25
/25 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

5f22 A R1A_CVHSA Non-structural protein 7[79 aa] B 100.0
/96.5 25
/25 R1AB_CVHSA Non-structural protein

6m5i B R1A_SARS2 Non-structural protein 7[81 aa] A 100.0
/100.0 24
/24 R1A_SARS2 Non-structural protein 8

6m71 B R1AB_SARS2 Non-structural protein 7[70 aa] C 100.0
/100.0 22
/22 R1AB_SARS2 Non-structural protein 8

6m71 B R1AB_SARS2 Non-structural protein 7[70 aa] D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

6nur C R1AB_CVHSA NSP7[70 aa] B 100.0
/96.5 5
/5 R1A_CVHSA NSP8

6nur C R1AB_CVHSA NSP7[70 aa] D 100.0
/96.3 24
/24 R1A_CVHSA NSP8

6wiq A R1AB_SARS2 Non-structural protein 7[80 aa] B 100.0
/100.0 25
/25 R1AB_SARS2 Non-structural protein 8

6wiq A R1AB_SARS2 Non-structural protein 7[80 aa] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

6wiq A R1AB_SARS2 Non-structural protein 7[80 aa] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

6wiq A R1AB_SARS2 Non-structural protein 7[80 aa] B 100.0
/100.0 25
/25 R1AB_SARS2 Non-structural protein 8

6wqd A R1AB_SARS2 Non-structural protein 7[74 aa] B 100.0
/100.0 25
/25 R1AB_SARS2 Non-structural protein 8

6wqd C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 8

6wqd A R1AB_SARS2 Non-structural protein 7[74 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

6wqd C R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

6wtc A R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 23
/23 R1AB_SARS2 Non-structural protein 8

6wtc C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 8

6wtc A R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 8

6wtc C R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 23
/23 R1AB_SARS2 Non-structural protein 8

6xez C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

6xez C R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 15
/15 R1AB_SARS2 Non-structural protein 8

6xip A R1AB_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 23
/23 R1AB_SARS2 Non-structural protein 8

6xip C R1AB_SARS2 Non-structural protein 7[75 aa] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

6xip A R1AB_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

6xip C R1AB_SARS2 Non-structural protein 7[75 aa] D 100.0
/100.0 25
/25 R1AB_SARS2 Non-structural protein 8

6xqb C R1AB_SARS2 Non-structural protein 7[62 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

6yhu A R1A_SARS2 Replicase polyprotein 1a[71 aa] B 100.0
/100.0 26
/26 R1A_SARS2 Replicase polyprotein 1a

6yhu C R1A_SARS2 Replicase polyprotein 1a[71 aa] D 100.0
/100.0 25
/25 R1A_SARS2 Replicase polyprotein 1a

6yyt C R1AB_SARS2 nsp7[73 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 nsp8

6yyt C R1AB_SARS2 nsp7[73 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 nsp8

7aap C R1AB_SARS2 Non-structural protein 7[67 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7aap C R1AB_SARS2 Non-structural protein 7[67 aa] D 100.0
/100.0 14
/14 R1AB_SARS2 Non-structural protein 8

7b3b C R1AB_SARS2 Non-structural protein 7[62 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7b3c C R1AB_SARS2 Non-structural protein 7[62 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7b3d C R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 SARS-CoV-2 nsp8

7btf B R1AB_SARS2 Non-structural protein 7[68 aa] C 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7btf B R1AB_SARS2 Non-structural protein 7[68 aa] D 100.0
/100.0 21
/21 R1AB_SARS2 Non-structural protein 8

7bv1 C R1AB_SARS2 Non-structural protein 7[63 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7bv1 C R1AB_SARS2 Non-structural protein 7[63 aa] D 100.0
/100.0 16
/16 R1AB_SARS2 Non-structural protein 8

7bv2 C R1AB_SARS2 Non-structural protein 7[63 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7bw4 C R1AB_SARS2 Non-structural protein 7[65 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7bw4 C R1AB_SARS2 Non-structural protein 7[65 aa] D 100.0
/100.0 16
/16 R1AB_SARS2 Non-structural protein 8

7bzf C R1AB_SARS2 Non-structural protein 7[68 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7bzf C R1AB_SARS2 Non-structural protein 7[68 aa] D 100.0
/100.0 19
/19 R1AB_SARS2 Non-structural protein 8

7c2k C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7c2k C R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 23
/23 R1AB_SARS2 Non-structural protein 8

7ctt C R1AB_SARS2 Non-structural protein 7[63 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7ctt C R1AB_SARS2 Non-structural protein 7[63 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

7cxm C R1AB_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7cxm C R1AB_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 20
/20 R1AB_SARS2 Non-structural protein 8

7cxn C R1AB_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7cxn C R1AB_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 19
/19 R1AB_SARS2 Non-structural protein 8

7cyq C R1AB_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7cyq C R1AB_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 20
/20 R1AB_SARS2 Non-structural protein 8

7d4f B R1AB_SARS2 Non-structural protein 7[63 aa] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7d4f B R1AB_SARS2 Non-structural protein 7[63 aa] C 100.0
/100.0 21
/21 R1AB_SARS2 Non-structural protein 8

7dcd A R1A_SARS2 Non-structural protein 7[75 aa] B 100.0
/100.0 26
/26 R1A_SARS2 Non-structural protein 8

7dcd C R1A_SARS2 Non-structural protein 7[76 aa] D 100.0
/100.0 22
/22 R1A_SARS2 Non-structural protein 8

7dcd E R1A_SARS2 Non-structural protein 7[76 aa] F 100.0
/100.0 21
/21 R1A_SARS2 Non-structural protein 8

7dcd G R1A_SARS2 Non-structural protein 7[75 aa] H 100.0
/100.0 23
/23 R1A_SARS2 Non-structural protein 8

7dfg E R1AB_SARS2 Non-structural protein 7[69 aa] D 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7dfg E R1AB_SARS2 Non-structural protein 7[69 aa] F 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

7dfh C R1AB_SARS2 Non-structural protein 7[63 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7dfh C R1AB_SARS2 Non-structural protein 7[63 aa] D 100.0
/100.0 18
/18 R1AB_SARS2 Non-structural protein 8

7doi C R1AB_SARS2 Non-structural protein 7[69 aa] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7doi C R1AB_SARS2 Non-structural protein 7[69 aa] F 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

7dok E R1AB_SARS2 Non-structural protein 7[69 aa] D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7dok E R1AB_SARS2 Non-structural protein 7[69 aa] F 100.0
/100.0 23
/23 R1AB_SARS2 Non-structural protein 8

7dte C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7dte C R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

7ed5 C R1AB_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7ed5 C R1AB_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 23
/23 R1AB_SARS2 Non-structural protein 8

7egq C R1AB_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7egq C R1AB_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 19
/19 R1AB_SARS2 Non-structural protein 8

7egq K R1AB_SARS2 Non-structural protein 7[72 aa] J 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7egq K R1AB_SARS2 Non-structural protein 7[72 aa] L 100.0
/100.0 19
/19 R1AB_SARS2 Non-structural protein 8

7eiz C R1A_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7eiz C R1A_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 16
/16 R1AB_SARS2 Non-structural protein 8

7jlt A R1AB_SARS2 Non-structural protein 7[79 aa] B 100.0
/100.0 23
/23 R1AB_SARS2 Non-structural protein 8

7jlt C R1AB_SARS2 Non-structural protein 7[81 aa] B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 8

7jlt A R1AB_SARS2 Non-structural protein 7[79 aa] D 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7jlt C R1AB_SARS2 Non-structural protein 7[81 aa] D 100.0
/100.0 22
/22 R1AB_SARS2 Non-structural protein 8

7krn C R1AB_SARS2 Non-structural protein 7[75 aa] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7krn C R1AB_SARS2 Non-structural protein 7[75 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

7kro C R1AB_SARS2 Non-structural protein 7[75 aa] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7kro C R1AB_SARS2 Non-structural protein 7[75 aa] D 100.0
/100.0 22
/22 R1AB_SARS2 Non-structural protein 8

7krp C R1AB_SARS2 Non-structural protein 7[75 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7krp C R1AB_SARS2 Non-structural protein 7[75 aa] D 100.0
/100.0 22
/22 R1AB_SARS2 Non-structural protein 8

7l1f C R1AB_SARS2 Non-structural protein 7[63 aa] B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7oyg C R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 SARS-CoV-2 nsp8

7oyg H R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] G 100.0
/100.0 3
/3 R1AB_SARS2 SARS-CoV-2 nsp8

7ozu C R1AB_SARS2 Non-structural protein 7[62 aa] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7ozv C R1AB_SARS2 Non-structural protein 7[62 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7rdx C R1AB_SARS2 Non-structural protein 7[75 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7rdx C R1AB_SARS2 Non-structural protein 7[75 aa] D 100.0
/100.0 25
/25 R1AB_SARS2 Non-structural protein 8

7rdy C R1AB_SARS2 Non-structural protein 7[75 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7rdy C R1AB_SARS2 Non-structural protein 7[75 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

7rdz C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7rdz C R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 21
/21 R1AB_SARS2 Non-structural protein 8

7re0 C R1AB_SARS2 Non-structural protein 7[75 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7re0 C R1AB_SARS2 Non-structural protein 7[75 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

7re1 C R1AB_SARS2 Non-structural protein 7[75 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7re1 C R1AB_SARS2 Non-structural protein 7[75 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

7re2 C R1AB_SARS2 Non-structural protein 7[75 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7re2 C R1AB_SARS2 Non-structural protein 7[75 aa] D 100.0
/100.0 25
/25 R1AB_SARS2 Non-structural protein 8

7re3 C R1AB_SARS2 Non-structural protein 7[75 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7re3 C R1AB_SARS2 Non-structural protein 7[75 aa] D 100.0
/100.0 22
/22 R1AB_SARS2 Non-structural protein 8

7re3 K R1AB_SARS2 Non-structural protein 7[75 aa] G 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7re3 K R1AB_SARS2 Non-structural protein 7[75 aa] L 100.0
/100.0 22
/22 R1AB_SARS2 Non-structural protein 8

7uo4 C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uo4 C R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 25
/25 R1AB_SARS2 Non-structural protein 8

7uo7 C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7uo7 C R1AB_SARS2 Non-structural protein 7[73 aa] F 100.0
/100.0 23
/23 R1AB_SARS2 Non-structural protein 8

7uo9 C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7uo9 C R1AB_SARS2 Non-structural protein 7[73 aa] F 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

7uob C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7uob C R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 21
/21 R1AB_SARS2 Non-structural protein 8

7uoe C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 8

7uoe C R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

8gw1 C R1A_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gw1 C R1A_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 18
/18 R1AB_SARS2 Non-structural protein 8

8gwb C R1A_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

8gwb C R1A_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 26
/26 R1AB_SARS2 Non-structural protein 8

8gwe C R1A_SARS2 Replicase polyprotein 1a[78 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwe C R1A_SARS2 Replicase polyprotein 1a[78 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

8gwf C R1A_SARS2 Non-structural protein 7[78 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwf C R1A_SARS2 Non-structural protein 7[78 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

8gwg C R1A_SARS2 Non-structural protein 7[78 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwg C R1A_SARS2 Non-structural protein 7[78 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

8gwi C R1A_SARS2 Non-structural protein 7[78 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwi C R1A_SARS2 Non-structural protein 7[78 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

8gwk C R1A_SARS2 Non-structural protein 7[76 aa] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

8gwk C R1A_SARS2 Non-structural protein 7[76 aa] D 100.0
/100.0 25
/25 R1AB_SARS2 Non-structural protein 8

8gwm C R1A_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwm C R1A_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 19
/19 R1AB_SARS2 Non-structural protein 8

8gwn C R1A_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwn C R1A_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 18
/18 R1AB_SARS2 Non-structural protein 8

8gwo C R1A_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwo C R1A_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 20
/20 R1AB_SARS2 Non-structural protein 8

8gy6 C R1A_SARS2 Non-structural protein 7[56 aa] B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8gy6 C R1A_SARS2 Non-structural protein 7[56 aa] D 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 8

8sq9 C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

8sq9 C R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

8sqj C R1AB_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

8sqj C R1AB_SARS2 Non-structural protein 7[72 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

8sqk C R1AB_SARS2 Non-structural protein 7[73 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

8sqk C R1AB_SARS2 Non-structural protein 7[73 aa] D 100.0
/100.0 24
/24 R1AB_SARS2 Non-structural protein 8

6m71 A R1AB_SARS2 RNA-directed RNA polymerase[859 aa] C 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

6m71 A R1AB_SARS2 RNA-directed RNA polymerase[859 aa] D 100.0
/100.0 42
/42 R1AB_SARS2 Non-structural protein 8

6nur A R1AB_CVHSA NSP12[793 aa] B 100.0
/96.5 45
/45 R1A_CVHSA NSP8

6nur A R1AB_CVHSA NSP12[793 aa] D 100.0
/96.3 2
/2 R1A_CVHSA NSP8

6xez A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 34
/34 R1AB_SARS2 Non-structural protein 8

6xez A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] D 100.0
/100.0 11
/11 R1AB_SARS2 Non-structural protein 8

6xqb A R1AB_SARS2 RNA-directed RNA polymerase[801 aa] B 100.0
/100.0 36
/36 R1AB_SARS2 Non-structural protein 8

6xqb A R1AB_SARS2 RNA-directed RNA polymerase[801 aa] D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

6yyt A R1AB_SARS2 nsp12[853 aa] B 100.0
/100.0 44
/44 R1AB_SARS2 nsp8

6yyt A R1AB_SARS2 nsp12[853 aa] D 100.0
/100.0 10
/10 R1AB_SARS2 nsp8

7aap A R1AB_SARS2 Non-structural protein 12[911 aa] B 100.0
/100.0 42
/42 R1AB_SARS2 Non-structural protein 8

7aap A R1AB_SARS2 Non-structural protein 12[911 aa] D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7b3b A R1AB_SARS2 RNA-directed RNA polymerase nsp12[814 aa] B 100.0
/100.0 40
/40 R1AB_SARS2 Non-structural protein 8

7b3c A R1AB_SARS2 RNA-directed RNA polymerase nsp12[814 aa] B 100.0
/100.0 42
/42 R1AB_SARS2 Non-structural protein 8

7b3d A R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12[814 .. B 100.0
/100.0 41
/41 R1AB_SARS2 SARS-CoV-2 nsp8

7btf A R1AB_SARS2 RNA-directed RNA polymerase[915 aa] C 100.0
/100.0 48
/48 R1AB_SARS2 Non-structural protein 8

7btf A R1AB_SARS2 RNA-directed RNA polymerase[915 aa] D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7bv1 A R1AB_SARS2 RNA-directed RNA polymerase[836 aa] B 100.0
/100.0 41
/41 R1AB_SARS2 Non-structural protein 8

7bv1 A R1AB_SARS2 RNA-directed RNA polymerase[836 aa] D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7bv2 A R1AB_SARS2 RNA-directed RNA polymerase[834 aa] B 100.0
/100.0 40
/40 R1AB_SARS2 Non-structural protein 8

7bw4 A R1AB_SARS2 RNA-directed RNA polymerase[811 aa] B 100.0
/100.0 40
/40 R1AB_SARS2 Non-structural protein 8

7bzf A R1AB_SARS2 RNA-directed RNA polymerase[914 aa] B 100.0
/100.0 41
/41 R1AB_SARS2 Non-structural protein 8

7bzf A R1AB_SARS2 RNA-directed RNA polymerase[914 aa] D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7c2k A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 44
/44 R1AB_SARS2 Non-structural protein 8

7c2k A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 12
/12 R1AB_SARS2 Non-structural protein 8

7ctt A R1AB_SARS2 RNA-directed RNA polymerase[826 aa] B 100.0
/100.0 41
/41 R1AB_SARS2 Non-structural protein 8

7ctt A R1AB_SARS2 RNA-directed RNA polymerase[826 aa] D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7cxm A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 36
/36 R1AB_SARS2 Non-structural protein 8

7cxm A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] D 100.0
/100.0 14
/14 R1AB_SARS2 Non-structural protein 8

7cxn A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 31
/31 R1AB_SARS2 Non-structural protein 8

7cxn A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

7cyq A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 43
/43 R1AB_SARS2 Non-structural protein 8

7cyq A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

7d4f D R1AB_SARS2 RNA-directed RNA polymerase[898 aa] A 100.0
/100.0 41
/41 R1AB_SARS2 Non-structural protein 8

7d4f D R1AB_SARS2 RNA-directed RNA polymerase[898 aa] C 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7dfg C R1AB_SARS2 RNA-directed RNA polymerase[908 aa] D 100.0
/100.0 46
/46 R1AB_SARS2 Non-structural protein 8

7dfg C R1AB_SARS2 RNA-directed RNA polymerase[908 aa] F 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7dfh A R1AB_SARS2 RNA-directed RNA polymeras[908 aa] B 100.0
/100.0 41
/41 R1AB_SARS2 Non-structural protein 8

7dfh A R1AB_SARS2 RNA-directed RNA polymeras[908 aa] D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7doi A R1AB_SARS2 RNA-directed RNA polymerase[906 aa] B 100.0
/100.0 46
/46 R1AB_SARS2 Non-structural protein 8

7doi A R1AB_SARS2 RNA-directed RNA polymerase[906 aa] F 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7dok C R1AB_SARS2 RNA-directed RNA polymerase[925 aa] D 100.0
/100.0 44
/44 R1AB_SARS2 Non-structural protein 8

7dok C R1AB_SARS2 RNA-directed RNA polymerase[925 aa] F 100.0
/100.0 14
/14 R1AB_SARS2 Non-structural protein 8

7dte A R1AB_SARS2 RNA-directed RNA polymerase[928 aa] B 100.0
/100.0 44
/44 R1AB_SARS2 Non-structural protein 8

7dte A R1AB_SARS2 RNA-directed RNA polymerase[928 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

7ed5 A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 47
/47 R1AB_SARS2 Non-structural protein 8

7ed5 A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] D 100.0
/100.0 14
/14 R1AB_SARS2 Non-structural protein 8

7egq A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 32
/32 R1AB_SARS2 Non-structural protein 8

7egq A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] D 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 8

7egq I R1AB_SARS2 RNA-directed RNA polymerase[926 aa] J 100.0
/100.0 37
/37 R1AB_SARS2 Non-structural protein 8

7egq I R1AB_SARS2 RNA-directed RNA polymerase[926 aa] L 100.0
/100.0 12
/12 R1AB_SARS2 Non-structural protein 8

7eiz A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 34
/34 R1AB_SARS2 Non-structural protein 8

7eiz A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] D 100.0
/100.0 12
/12 R1AB_SARS2 Non-structural protein 8

7krn A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 44
/44 R1AB_SARS2 Non-structural protein 8

7krn A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 15
/15 R1AB_SARS2 Non-structural protein 8

7kro A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 41
/41 R1AB_SARS2 Non-structural protein 8

7kro A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 14
/14 R1AB_SARS2 Non-structural protein 8

7krp A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 43
/43 R1AB_SARS2 Non-structural protein 8

7krp A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 14
/14 R1AB_SARS2 Non-structural protein 8

7l1f A R1AB_SARS2 RNA-directed RNA polymerase[832 aa] B 100.0
/100.0 36
/36 R1AB_SARS2 Non-structural protein 8

7oyg A R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)[81.. B 100.0
/100.0 25
/25 R1AB_SARS2 SARS-CoV-2 nsp8

7oyg F R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)[81.. G 100.0
/100.0 25
/25 R1AB_SARS2 SARS-CoV-2 nsp8

7ozu A R1AB_SARS2 Replicase polyprotein 1ab[814 aa] B 100.0
/100.0 40
/40 R1AB_SARS2 Non-structural protein 8

7ozv A R1AB_SARS2 Replicase polyprotein 1ab[814 aa] B 100.0
/100.0 42
/42 R1AB_SARS2 Non-structural protein 8

7rdx A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 44
/44 R1AB_SARS2 Non-structural protein 8

7rdx A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 16
/16 R1AB_SARS2 Non-structural protein 8

7rdy A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 41
/41 R1AB_SARS2 Non-structural protein 8

7rdy A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

7rdz A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 40
/40 R1AB_SARS2 Non-structural protein 8

7rdz A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 15
/15 R1AB_SARS2 Non-structural protein 8

7re0 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 43
/43 R1AB_SARS2 Non-structural protein 8

7re0 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

7re1 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 44
/44 R1AB_SARS2 Non-structural protein 8

7re1 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 16
/16 R1AB_SARS2 Non-structural protein 8

7re2 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 42
/42 R1AB_SARS2 Non-structural protein 8

7re2 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 15
/15 R1AB_SARS2 Non-structural protein 8

7re3 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 39
/39 R1AB_SARS2 Non-structural protein 8

7re3 J R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7re3 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 12
/12 R1AB_SARS2 Non-structural protein 8

7re3 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] G 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7re3 J R1AB_SARS2 RNA-directed RNA polymerase[927 aa] G 100.0
/100.0 39
/39 R1AB_SARS2 Non-structural protein 8

7re3 J R1AB_SARS2 RNA-directed RNA polymerase[927 aa] L 100.0
/100.0 12
/12 R1AB_SARS2 Non-structural protein 8

7thm A R1AB_SARS2 RNA-directed RNA polymerase[860 aa] B 100.0
/100.0 35
/35 R1AB_SARS2 Non-structural protein 8

7uo4 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 44
/44 R1AB_SARS2 Non-structural protein 8

7uo4 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] D 100.0
/100.0 14
/14 R1AB_SARS2 Non-structural protein 8

7uo7 A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 42
/42 R1AB_SARS2 Non-structural protein 8

7uo7 A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] F 100.0
/100.0 14
/14 R1AB_SARS2 Non-structural protein 8

7uo9 A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 42
/42 R1AB_SARS2 Non-structural protein 8

7uo9 A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] F 100.0
/100.0 12
/12 R1AB_SARS2 Non-structural protein 8

7uob A R1AB_SARS2 RNA-directed RNA polymerase[929 aa] B 100.0
/100.0 38
/38 R1AB_SARS2 Non-structural protein 8

7uob A R1AB_SARS2 RNA-directed RNA polymerase[929 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

7uoe A R1AB_SARS2 RNA-directed RNA polymerase[929 aa] B 100.0
/100.0 46
/46 R1AB_SARS2 Non-structural protein 8

7uoe A R1AB_SARS2 RNA-directed RNA polymerase[929 aa] D 100.0
/100.0 14
/14 R1AB_SARS2 Non-structural protein 8

8gw1 A R1AB_SARS2 Replicase polyprotein 1ab[928 aa] B 100.0
/100.0 39
/39 R1AB_SARS2 Non-structural protein 8

8gw1 A R1AB_SARS2 Replicase polyprotein 1ab[928 aa] D 100.0
/100.0 12
/12 R1AB_SARS2 Non-structural protein 8

8gwb A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 47
/47 R1AB_SARS2 Non-structural protein 8

8gwb A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] D 100.0
/100.0 15
/15 R1AB_SARS2 Non-structural protein 8

8gwe A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] B 100.0
/100.0 38
/38 R1AB_SARS2 Non-structural protein 8

8gwe A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

8gwf A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] B 100.0
/100.0 38
/38 R1AB_SARS2 Non-structural protein 8

8gwf A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

8gwg A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] B 100.0
/100.0 38
/38 R1AB_SARS2 Non-structural protein 8

8gwg A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

8gwi A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] B 100.0
/100.0 38
/38 R1AB_SARS2 Non-structural protein 8

8gwi A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

8gwk A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] B 100.0
/100.0 38
/38 R1AB_SARS2 Non-structural protein 8

8gwk A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

8gwm A R1AB_SARS2 RNA-directed RNA polymerase[928 aa] B 100.0
/100.0 39
/39 R1AB_SARS2 Non-structural protein 8

8gwm A R1AB_SARS2 RNA-directed RNA polymerase[928 aa] D 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 8

8gwn A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 34
/34 R1AB_SARS2 Non-structural protein 8

8gwn A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] D 100.0
/100.0 14
/14 R1AB_SARS2 Non-structural protein 8

8gwo A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 34
/34 R1AB_SARS2 Non-structural protein 8

8gwo A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] D 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 8

8gy6 A R1AB_SARS2 RNA-directed RNA polymerase[859 aa] B 100.0
/100.0 39
/39 R1AB_SARS2 Non-structural protein 8

8sq9 A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] B 100.0
/100.0 43
/43 R1AB_SARS2 Non-structural protein 8

8sq9 A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

8sqj A R1AB_SARS2 RNA-directed RNA polymerase[929 aa] B 100.0
/100.0 37
/37 R1AB_SARS2 Non-structural protein 8

8sqj A R1AB_SARS2 RNA-directed RNA polymerase[929 aa] D 100.0
/100.0 11
/11 R1AB_SARS2 Non-structural protein 8

8sqk A R1AB_SARS2 RNA-directed RNA polymerase nsp12[929 aa] B 100.0
/100.0 37
/37 R1AB_SARS2 Non-structural protein 8

8sqk A R1AB_SARS2 RNA-directed RNA polymerase nsp12[929 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

6xez F R1AB_SARS2 Helicase[596 aa] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

6xez E R1AB_SARS2 Helicase[596 aa] D 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7cxm H R1AB_SARS2 Helicase[596 aa] B 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 8

7cxm I R1AB_SARS2 Helicase[596 aa] D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7cxn H R1AB_SARS2 Helicase[596 aa] B 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 8

7cxn I R1AB_SARS2 Helicase[596 aa] D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7cyq G R1AB_SARS2 Helicase[585 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7cyq H R1AB_SARS2 Helicase[586 aa] B 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 8

7cyq G R1AB_SARS2 Helicase[585 aa] D 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 8

7egq E R1AB_SARS2 Helicase[588 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7egq Q R1AB_SARS2 Helicase[596 aa] B 100.0
/100.0 11
/11 R1AB_SARS2 Non-structural protein 8

7egq E R1AB_SARS2 Helicase[588 aa] D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7egq M R1AB_SARS2 Helicase[588 aa] J 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7egq R R1AB_SARS2 Helicase[596 aa] J 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

7eiz J R1AB_SARS2 Helicase[587 aa] B 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 8

7eiz K R1AB_SARS2 Helicase[590 aa] B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7eiz K R1AB_SARS2 Helicase[590 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

7krn E R1AB_SARS2 Helicase[590 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

7kro F R1AB_SARS2 Helicase[590 aa] B 100.0
/100.0 12
/12 R1AB_SARS2 Non-structural protein 8

7kro E R1AB_SARS2 Helicase[590 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

7rdx F R1AB_SARS2 Helicase[590 aa] B 100.0
/100.0 12
/12 R1AB_SARS2 Non-structural protein 8

7rdx E R1AB_SARS2 Helicase[590 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

7rdy F R1AB_SARS2 Helicase[590 aa] B 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 8

7rdy E R1AB_SARS2 Helicase[590 aa] D 100.0
/100.0 13
/13 R1AB_SARS2 Non-structural protein 8

7rdz F R1AB_SARS2 Helicase[590 aa] B 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 8

7rdz E R1AB_SARS2 Helicase[590 aa] D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7re0 E R1AB_SARS2 Helicase[590 aa] B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7re0 F R1AB_SARS2 Helicase[590 aa] B 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 8

7re0 E R1AB_SARS2 Helicase[590 aa] D 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 8

7re1 F R1AB_SARS2 Helicase[590 aa] B 100.0
/100.0 11
/11 R1AB_SARS2 Non-structural protein 8

7re1 E R1AB_SARS2 Helicase[590 aa] D 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7re2 E R1AB_SARS2 Helicase[590 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

7re3 F R1AB_SARS2 Helicase[590 aa] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7re3 E R1AB_SARS2 Helicase[590 aa] D 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 8

7re3 N R1AB_SARS2 Helicase[590 aa] G 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

7re3 M R1AB_SARS2 Helicase[590 aa] L 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 8

8gw1 G R1AB_SARS2 Helicase[585 aa] B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8gw1 H R1AB_SARS2 Helicase[585 aa] B 100.0
/100.0 11
/11 R1AB_SARS2 Non-structural protein 8

8gw1 G R1AB_SARS2 Helicase[585 aa] D 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 8

8gwb E R1AB_SARS2 Helicase[585 aa] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

8gwb F R1AB_SARS2 Helicase[586 aa] B 100.0
/100.0 11
/11 R1AB_SARS2 Non-structural protein 8

8gwb E R1AB_SARS2 Helicase[585 aa] D 100.0
/100.0 11
/11 R1AB_SARS2 Non-structural protein 8

8gwe E R1AB_SARS2 Helicase nsp13[586 aa] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

8gwe F R1AB_SARS2 Helicase nsp13[586 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwe F R1AB_SARS2 Helicase nsp13[586 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

8gwf G R1AB_SARS2 Helicase[586 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwf H R1AB_SARS2 Helicase[586 aa] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

8gwf G R1AB_SARS2 Helicase[586 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

8gwg G R1AB_SARS2 Helicase[586 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwg H R1AB_SARS2 Helicase[586 aa] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

8gwg G R1AB_SARS2 Helicase[586 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

8gwi G R1AB_SARS2 Helicase[586 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwi H R1AB_SARS2 Helicase[586 aa] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

8gwi G R1AB_SARS2 Helicase[586 aa] D 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

8gwk G R1AB_SARS2 Helicase[585 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwk H R1AB_SARS2 Helicase[585 aa] B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 8

8gwk G R1AB_SARS2 Helicase[585 aa] D 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

8gwm E R1AB_SARS2 Helicase[585 aa] B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8gwm F R1AB_SARS2 Helicase[585 aa] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

8gwm E R1AB_SARS2 Helicase[585 aa] D 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

8gwn G R1AB_SARS2 Helicase[585 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwn H R1AB_SARS2 Helicase[586 aa] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

8gwn G R1AB_SARS2 Helicase[585 aa] D 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 8

8gwo G R1AB_SARS2 Helicase[585 aa] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwo H R1AB_SARS2 Helicase[586 aa] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

8gwo G R1AB_SARS2 Helicase[585 aa] D 100.0
/100.0 12
/12 R1AB_SARS2 Non-structural protein 8

7egq P R1AB_SARS2 Proofreading exoribonuclease[524 aa] D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7thm C R1AB_SARS2 Non-structural protein 7[37 aa] D 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 8

6nus A R1AB_CVHSA NSP12[715 aa] B 100.0
/96.4 40
/40 R1A_CVHSA NSP8

9cpo A R1AB_IBVM RNA-directed RNA polymerase nsp12[930 aa] B 43.9
/44.0 41
/41 R1AB_IBVM Non-structural protein 8

9cpo A R1AB_IBVM RNA-directed RNA polymerase nsp12[930 aa] D 50.0
/44.0 12
/12 R1AB_IBVM Non-structural protein 8

9cpo C R1AB_IBVM Non-structural protein 7[72 aa] B 100.0
/44.0 3
/3 R1AB_IBVM Non-structural protein 8

9cpo C R1AB_IBVM Non-structural protein 7[72 aa] D 46.2
/44.0 26
/26 R1AB_IBVM Non-structural protein 8

8g6r A A0A0U2C263_9ALPC nsp12[899 aa] B 50.0
/38.4 42
/42 A0A1Z2R8Q6_9ALPC nsp8

8urb A U6BRU0_9ALPC nsp12[921 aa] B 45.0
/44.0 40
/40 U6BRU0_9ALPC nsp8

8urb A U6BRU0_9ALPC nsp12[921 aa] D 45.5
/43.3 11
/11 U6BRU0_9ALPC nsp8

8g6r C A0A0M4AW09_9ALPC nsp7[62 aa] B 50.0
/38.4 2
/2 A0A1Z2R8Q6_9ALPC nsp8

8urb C U6BRU0_9ALPC nsp7[70 aa] B 33.3
/44.0 3
/3 U6BRU0_9ALPC nsp8

8urb C U6BRU0_9ALPC nsp7[70 aa] D 60.0
/43.3 20
/21 U6BRU0_9ALPC nsp8

3ub0 B R1AB_FIPV Non-structural protein 7, nsp7[82 aa] A 33.3
/42.7 12
/12 R1AB_FIPV Non-structural protein 6, nsp6,

3ub0 C R1AB_FIPV Non-structural protein 7, nsp7[82 aa] A 61.3
/42.7 31
/31 R1AB_FIPV Non-structural protein 6, nsp6,

3ub0 E R1AB_FIPV Non-structural protein 7, nsp7[81 aa] D 30.0
/43.2 10
/10 R1AB_FIPV Non-structural protein 6, nsp6,

3ub0 F R1AB_FIPV Non-structural protein 7, nsp7[78 aa] D 55.2
/43.2 29
/29 R1AB_FIPV Non-structural protein 6, nsp6,

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

198 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6xez G Product RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

6xez G Product RNA D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7rdx G Product RNA B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7rdx G Product RNA D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7rdy G Product RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7rdy G Product RNA D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7rdz G Product RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7rdz G Product RNA D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7re0 G Product RNA B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7re0 G Product RNA D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7re1 G Product RNA B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7re1 G Product RNA D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7re2 F Product RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7re2 F Product RNA D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7re3 H Product RNA B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7re3 H Product RNA D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7re3 O Product RNA G 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7re3 O Product RNA L 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

6xez H Template RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

6xez H Template RNA D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

6yyt F RNA product B 100.0
/100.0 4
/4 R1AB_SARS2 nsp8

6yyt H RNA product B 100.0
/100.0 4
/4 R1AB_SARS2 nsp8

6yyt F RNA product D 100.0
/100.0 3
/3 R1AB_SARS2 nsp8

6yyt H RNA product D 100.0
/100.0 2
/2 R1AB_SARS2 nsp8

6yyt G RNA product D 100.0
/100.0 3
/3 R1AB_SARS2 nsp8

7c2k E RNA (29-MER) D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7cxm E RNA (25-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7cxm E RNA (25-MER) D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7cxn E Primer RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7cxn E Primer RNA D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7egq S primer RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7egq S primer RNA D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7egq U primer RNA J 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7egq U primer RNA L 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7eiz G primer B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7eiz G primer D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gw1 E RNA (25-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gw1 E RNA (25-MER) D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwb I primer B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwb I primer D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwe I primer B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwe I primer D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8gwf E primer B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwf E primer D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8gwg E primer B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwg E primer D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8gwi E primer B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwi E primer D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8gwk E primer B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

8gwk E primer D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwm H RNA (25-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwm H RNA (25-MER) D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwn E primer B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwn E primer D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8gwo E RNA (25-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwo E RNA (25-MER) D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7cxm F RNA (26-MER) B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7cxm F RNA (26-MER) D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7cxn F Template RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7cxn F Template RNA D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7cyq E Primer B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7cyq E Primer D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7cyq F Template B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7cyq F Template D 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7dok A RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7dok A RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. F 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7ed5 E RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7ed5 E RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. D 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7dok B RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. F 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7dte E RNA (57-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7dte E RNA (57-MER) D 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7dte F RNA (33-MER) B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7dte F RNA (33-MER) D 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7ed5 F RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7ed5 F RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. D 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7egq T Template RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7egq T Template RNA D 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7egq V Template RNA J 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7eiz H template B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7eiz H template D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwe J template B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwe J template D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7krn F RNA (37-MER) B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7krn F RNA (37-MER) D 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7kro G RNA (37-MER) B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7kro G RNA (37-MER) D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7krp E RNA (37-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7krp E RNA (37-MER) D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7krn G RNA (43-MER) B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7krn G RNA (43-MER) D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7kro H RNA (43-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7kro H RNA (43-MER) D 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7krp F RNA (36-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7krp F RNA (36-MER) D 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7rdx H Template RNA B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7rdx H Template RNA D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7rdy H Template RNA B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7rdy H Template RNA D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7rdz H Template RNA B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7rdz H Template RNA D 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7re0 H Template RNA B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7re0 H Template RNA D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7re1 H Template RNA B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7re1 H Template RNA D 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7re2 G Template RNA B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7re2 G Template RNA D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7re3 I Template RNA B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7re3 I Template RNA D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7re3 P Template RNA G 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7re3 P Template RNA L 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7uo4 E Product RNA (35-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uo4 E Product RNA (35-MER) D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uo4 F Template RNA (55-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7uo4 F Template RNA (55-MER) D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7uo7 D Product RNA (35-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uo7 D Product RNA (35-MER) F 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7uo7 E Template RNA (55-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uo7 E Template RNA (55-MER) F 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7uo9 D Product RNA (35-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7uo9 D Product RNA (35-MER) F 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7uo9 E Template RNA (55-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7uo9 E Template RNA (55-MER) F 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

8sq9 G Template RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8sq9 G Template RNA D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7uob E Product RNA (35-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7uob E Product RNA (35-MER) D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uoe E Product RNA (35-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uoe E Product RNA (35-MER) D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uob F Template RNA (55-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uob F Template RNA (55-MER) D 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7uoe F Template RNA (55-MER) B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7uoe F Template RNA (55-MER) D 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 8

8gw1 F Template B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gw1 F Template D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

8gwk F template B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8gwk F template D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwm I RNA (26-MER) B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8gwm I RNA (26-MER) D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8gwb J template B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

8gwb J template D 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 8

8gwf F template B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwf F template D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwg F Template B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwg F Template D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwi F RNA (27-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8gwi F RNA (27-MER) D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwn F template B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwn F template D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwo F template B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8gwo F template D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

8sq9 F Primer RNA B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8sq9 F Primer RNA D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8sqj F Primer RNA B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8sqj F Primer RNA D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8sqj G Template RNA B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

8sqj G Template RNA D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

8sqk F Primer RNA B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8sqk G Template RNA B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

8sqk G Template RNA D 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

9cpo E RNA Primer B 60.0
/44.0 5
/5 R1AB_IBVM Non-structural protein 8

9cpo E RNA Primer D 66.7
/44.0 3
/3 R1AB_IBVM Non-structural protein 8

9cpo F RNA template B 100.0
/44.0 2
/2 R1AB_IBVM Non-structural protein 8

9cpo F RNA template D 60.0
/44.0 5
/5 R1AB_IBVM Non-structural protein 8

8urb E RNA (33-MER) B 50.0
/44.0 2
/2 U6BRU0_9ALPC nsp8

8urb E RNA (33-MER) D 66.7
/43.3 3
/3 U6BRU0_9ALPC nsp8

8urb F RNA (55-MER) D 100.0
/43.3 2
/2 U6BRU0_9ALPC nsp8

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

198 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7krn T 1N7
CHAPSO[36 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7kro U 1N7
CHAPSO[36 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7krp M 1N7
CHAPSO[36 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7rdx U 1N7
CHAPSO[36 atoms] D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7rdy O 1N7
CHAPSO[36 atoms] D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7re1 U 1N7
CHAPSO[36 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7re2 T 1N7
CHAPSO[36 atoms] D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7re3 AA 1N7
CHAPSO[36 atoms] D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7re3 RA 1N7
CHAPSO[36 atoms] L 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

198 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2ahm E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] E 100.0
/97.4 19
/19 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] E 100.0
/97.4 19
/19 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm G R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] E 100.0
/97.4 5
/5 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm G R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] E 100.0
/97.4 8
/8 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm G R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] E 100.0
/97.4 8
/8 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm G R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] E 100.0
/97.4 5
/5 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] E 100.0
/97.4 5
/5 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] E 100.0
/97.4 5
/5 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm F R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] F 100.0
/97.2 18
/18 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm F R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] F 100.0
/97.2 18
/18 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] F 100.0
/97.2 6
/6 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] F 100.0
/97.2 9
/9 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] F 100.0
/97.2 9
/9 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] F 100.0
/97.2 6
/6 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] G 100.0
/97.4 7
/7 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] G 100.0
/97.4 7
/7 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] G 100.0
/97.4 7
/7 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] G 100.0
/97.4 7
/7 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] G 100.0
/97.4 9
/9 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] G 100.0
/97.4 9
/9 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] H 100.0
/97.4 7
/7 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] H 100.0
/97.4 7
/7 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm F R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[143 aa] H 100.0
/97.4 7
/7 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm F <

MONOMER
198
	pdb_id	a¹	identity[%]²	description
	7uo9	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwe	B	100.0	R1AB_SARS2 Non-structural protein 8
	7uoe	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwf	D	100.0	R1AB_SARS2 Non-structural protein 8
	8gwi	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwg	D	100.0	R1AB_SARS2 Non-structural protein 8
	8gwg	B	100.0	R1AB_SARS2 Non-structural protein 8
	7uob	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwo	B	100.0	R1AB_SARS2 Non-structural protein 8
	7uo4	D	100.0	R1AB_SARS2 Non-structural protein 8
	8sqk	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwe	D	100.0	R1AB_SARS2 Non-structural protein 8
	7cxm	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwn	B	100.0	R1AB_SARS2 Non-structural protein 8
	7cyq	B	100.0	R1AB_SARS2 Non-structural protein 8
	7cxn	B	100.0	R1AB_SARS2 Non-structural protein 8
	8sqj	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwk	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwi	D	100.0	R1AB_SARS2 Non-structural protein 8
	8gw1	B	100.0	R1AB_SARS2 Non-structural protein 8
	7egq	J	100.0	R1AB_SARS2 Non-structural protein 8
	7egq	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwm	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwb	B	100.0	R1AB_SARS2 Non-structural protein 8
	7uo4	B	100.0	R1AB_SARS2 Non-structural protein 8
	7eiz	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwf	B	100.0	R1AB_SARS2 Non-structural protein 8
	7dte	B	100.0	R1AB_SARS2 Non-structural protein 8
	2ahm	H	97.4	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	2ahm	G	97.4	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	7uoe	D	100.0	R1AB_SARS2 Non-structural protein 8
	7uob	D	100.0	R1AB_SARS2 Non-structural protein 8
	7uo9	F	100.0	R1AB_SARS2 Non-structural protein 8
	7uo7	F	100.0	R1AB_SARS2 Non-structural protein 8
	7uo7	B	100.0	R1AB_SARS2 Non-structural protein 8
	7eiz	D	100.0	R1AB_SARS2 Non-structural protein 8
	8sq9	D	100.0	R1AB_SARS2 Non-structural protein 8
	7cxm	D	100.0	R1AB_SARS2 Non-structural protein 8
	8gwo	D	100.0	R1AB_SARS2 Non-structural protein 8
	8gwn	D	100.0	R1AB_SARS2 Non-structural protein 8
	8gw1	D	100.0	R1AB_SARS2 Non-structural protein 8
	7cyq	D	100.0	R1AB_SARS2 Non-structural protein 8
	7cxn	D	100.0	R1AB_SARS2 Non-structural protein 8
	8sq9	B	100.0	R1AB_SARS2 Non-structural protein 8
	8gwb	D	100.0	R1AB_SARS2 Non-structural protein 8
	7egq	L	100.0	R1AB_SARS2 Non-structural protein 8
	7egq	D	100.0	R1AB_SARS2 Non-structural protein 8
	8gwk	D	100.0	R1AB_SARS2 Non-structural protein 8
	8gwm	D	100.0	R1AB_SARS2 Non-structural protein 8
	7re3	G	100.0	R1AB_SARS2 Non-structural protein 8
	6xez	D	100.0	R1AB_SARS2 Non-structural protein 8
	7re1	B	100.0	R1AB_SARS2 Non-structural protein 8
	7re3	B	100.0	R1AB_SARS2 Non-structural protein 8
	7re2	B	100.0	R1AB_SARS2 Non-structural protein 8
	7kro	B	100.0	R1AB_SARS2 Non-structural protein 8
	7krp	B	100.0	R1AB_SARS2 Non-structural protein 8
	7re0	B	100.0	R1AB_SARS2 Non-structural protein 8
	7rdz	B	100.0	R1AB_SARS2 Non-structural protein 8
	7rdy	B	100.0	R1AB_SARS2 Non-structural protein 8
	7rdx	B	100.0	R1AB_SARS2 Non-structural protein 8
	6xez	B	100.0	R1AB_SARS2 Non-structural protein 8
	7krn	B	100.0	R1AB_SARS2 Non-structural protein 8
	7dte	D	100.0	R1AB_SARS2 Non-structural protein 8
	6yyt	D	100.0	R1AB_SARS2 nsp8
	6yyt	B	100.0	R1AB_SARS2 nsp8
	8sqj	D	100.0	R1AB_SARS2 Non-structural protein 8
	8sqk	D	100.0	R1AB_SARS2 Non-structural protein 8
	7krn	D	100.0	R1AB_SARS2 Non-structural protein 8
	7re2	D	100.0	R1AB_SARS2 Non-structural protein 8
	7re1	D	100.0	R1AB_SARS2 Non-structural protein 8
	7re0	D	100.0	R1AB_SARS2 Non-structural protein 8
	7re3	L	100.0	R1AB_SARS2 Non-structural protein 8
	7re3	D	100.0	R1AB_SARS2 Non-structural protein 8
	7rdy	D	100.0	R1AB_SARS2 Non-structural protein 8
	7rdz	D	100.0	R1AB_SARS2 Non-structural protein 8
	7rdx	D	100.0	R1AB_SARS2 Non-structural protein 8
	7krp	D	100.0	R1AB_SARS2 Non-structural protein 8
	7kro	D	100.0	R1AB_SARS2 Non-structural protein 8
	7dok	F	100.0	R1AB_SARS2 Non-structural protein 8
	7dok	D	100.0	R1AB_SARS2 Non-structural protein 8
	7ed5	D	100.0	R1AB_SARS2 Non-structural protein 8
	2ahm	E	97.4	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	7ed5	B	100.0	R1AB_SARS2 Non-structural protein 8
	2ahm	F	97.2	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	7c2k	D	100.0	R1AB_SARS2 Non-structural protein 8
	7btf	C	100.0	R1AB_SARS2 Non-structural protein 8
	6wqd	B	100.0	R1AB_SARS2 Non-structural protein 8
	6yhu	B	100.0	R1A_SARS2 Replicase polyprotein 1a
	6xip	D	100.0	R1AB_SARS2 Non-structural protein 8
	7dcd	D	100.0	R1A_SARS2 Non-structural protein 8
	7dcd	B	100.0	R1A_SARS2 Non-structural protein 8
	6yhu	D	100.0	R1A_SARS2 Replicase polyprotein 1a
	6wtc	D	100.0	R1AB_SARS2 Non-structural protein 8
	7dfg	D	100.0	R1AB_SARS2 Non-structural protein 8
	6wtc	B	100.0	R1AB_SARS2 Non-structural protein 8
	7jlt	D	100.0	R1AB_SARS2 Non-structural protein 8
	7c2k	B	100.0	R1AB_SARS2 Non-structural protein 8
	6wiq	B	100.0	R1AB_SARS2 Non-structural protein 8
	6xip	B	100.0	R1AB_SARS2 Non-structural protein 8
	7jlt	B	100.0	R1AB_SARS2 Non-structural protein 8
	7dcd	H	100.0	R1A_SARS2 Non-structural protein 8
	7l1f	B	100.0	R1AB_SARS2 Non-structural protein 8
	6wqd	D	100.0	R1AB_SARS2 Non-structural protein 8
	6m5i	A	100.0	R1A_SARS2 Non-structural protein 8
	7b3d	B	100.0	R1AB_SARS2 SARS-CoV-2 nsp8
	7b3c	B	100.0	R1AB_SARS2 Non-structural protein 8
	7b3b	B	100.0	R1AB_SARS2 Non-structural protein 8
	7bw4	B	100.0	R1AB_SARS2 Non-structural protein 8
	7ozv	B	100.0	R1AB_SARS2 Non-structural protein 8
	7ozu	B	100.0	R1AB_SARS2 Non-structural protein 8
	7dcd	F	100.0	R1A_SARS2 Non-structural protein 8
	7ctt	B	100.0	R1AB_SARS2 Non-structural protein 8
	7aap	B	100.0	R1AB_SARS2 Non-structural protein 8
	7doi	B	100.0	R1AB_SARS2 Non-structural protein 8
	7d4f	A	100.0	R1AB_SARS2 Non-structural protein 8
	7dfh	B	100.0	R1AB_SARS2 Non-structural protein 8
	7bzf	B	100.0	R1AB_SARS2 Non-structural protein 8
	7bv2	B	100.0	R1AB_SARS2 Non-structural protein 8
	7bv1	B	100.0	R1AB_SARS2 Non-structural protein 8
	6xqb	B	100.0	R1AB_SARS2 Non-structural protein 8
	5f22	B	96.5	R1AB_CVHSA Non-structural protein
	8gy6	B	100.0	R1AB_SARS2 Non-structural protein 8
	6m71	D	100.0	R1AB_SARS2 Non-structural protein 8
	6nur	B	96.5	R1A_CVHSA NSP8
	6nus	B	96.4	R1A_CVHSA NSP8
	7thm	B	100.0	R1AB_SARS2 Non-structural protein 8
	7doi	F	100.0	R1AB_SARS2 Non-structural protein 8
	7d4f	C	100.0	R1AB_SARS2 Non-structural protein 8
	7dfg	F	100.0	R1AB_SARS2 Non-structural protein 8
	7dfh	D	100.0	R1AB_SARS2 Non-structural protein 8
	6nur	D	96.3	R1A_CVHSA NSP8
	7bzf	D	100.0	R1AB_SARS2 Non-structural protein 8
	7btf	D	100.0	R1AB_SARS2 Non-structural protein 8
	7bv1	D	100.0	R1AB_SARS2 Non-structural protein 8
	8urb	B	44.0	U6BRU0_9ALPC nsp8
	7bw4	D	100.0	R1AB_SARS2 Non-structural protein 8
	7oyg	B	100.0	R1AB_SARS2 SARS-CoV-2 nsp8
	7oyg	G	100.0	R1AB_SARS2 SARS-CoV-2 nsp8
	8urb	D	43.3	U6BRU0_9ALPC nsp8
	7ywr	A	100.0	A0A8A0A7W8_SARS2 ORF1a polyprotein
	3ub0	D	43.2	R1AB_FIPV Non-structural protein 6, nsp6,
	3ub0	A	42.7	R1AB_FIPV Non-structural protein 6, nsp6,
	9cpo	D	44.0	R1AB_IBVM Non-structural protein 8
	9cpo	B	44.0	R1AB_IBVM Non-structural protein 8
	7thm	D	100.0	R1AB_SARS2 Non-structural protein 8
	8g6r	B	38.4	A0A1Z2R8Q6_9ALPC nsp8
	6m71	C	100.0	R1AB_SARS2 Non-structural protein 8
	8gy6	D	100.0	R1AB_SARS2 Non-structural protein 8
	6xqb	D	100.0	R1AB_SARS2 Non-structural protein 8
	7ctt	D	100.0	R1AB_SARS2 Non-structural protein 8
	7aap	D	100.0	R1AB_SARS2 Non-structural protein 8
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

Contact Molecules for Homologous Proteins

Full Bars[0.0 %]

UniProt Feature Tables [YP_009725304.1()]