#WARNING:Can't open blastfile '/mounts/filesv4_homcos_data/TMPOUTSCH/2080.bltA' #WARNING:Can't open blastfile '/mounts/filesv4_homcos_data/TMPOUTSCH/2080.psiA'

[Full Bars]

[SiteTable]


Summary Bars[50 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2080 221 0 P59596(VME1_SARS) RecName: Full=Membrane protein ; Short=M protein ;AltName: Full=E1 glycoprotein ;AltName: Full=Matrix glycoprotein ;AltName: Full=Membrane glycoprotein ;
QUERYSEQ
MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRM
AGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59596(VME1_SARS)]

221
region name description
1-221 CHAIN /note="Membrane protein" /id="PRO_0000106035"
1-18 TOPO_DOM /note="Virion surface"
19-39 TRANSMEM /note="Helical"
40-49 TOPO_DOM /note="Intravirion"
50-70 TRANSMEM /note="Helical"
71-78 TOPO_DOM /note="Virion surface"
79-99 TRANSMEM /note="Helical"
100-221 TOPO_DOM /note="Intravirion"

No homologue is found in PDB.

Please check [SiteTable] for homologues.