Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[95 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
9058 422 112 P59595(NCAP_SARS) RecName: Full=Nucleoprotein ;AltName: Full=Nucleocapsid protein ; Short=NC ; Short=Protein N ;
QUERYSEQ 
MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTR
NPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYK
HWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59595(NCAP_SARS)]

422
region name description
1-422 CHAIN /note="Nucleoprotein" /id="PRO_0000106003"
49-176 DOMAIN /note="CoV N NTD"
248-365 DOMAIN /note="CoV N CTD"
1-52 REGION /note="Disordered"
42-187 REGION /note="RNA-binding"
45-181 REGION /note="RNA-binding"
167-214 REGION /note="Disordered"
177-204 REGION /note="SR region"
234-287 REGION /note="Disordered"
259-362 REGION /note="Dimerization"
362-422 REGION /note="Disordered"
1-35 COMPBIAS /note="Polar residues"
178-209 COMPBIAS /note="Polar residues"
234-252 COMPBIAS /note="Polar residues"
265-287 COMPBIAS /note="Polar residues"
363-383 COMPBIAS /note="Basic and acidic residues"
404-422 COMPBIAS /note="Polar residues"
93-93 BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697"
108-108 BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697"
150-150 BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697"
1-422 DISORDER predicted by DISOPRED

MONOMER
422
pdb_id a1 identity[%]2 description
1ssk A 99.3 NCAP_CVHSA Nucleocapsid protein
2jw8 B 100.0 NCAP_CVHSA Nucleocapsid protein 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7n0i[8] H Single-domain antibody E2[136 aa] A 90.0
/95.8		 10
/10		 NCAP_SARS2 Nucleoprotein
7ylb[8] C NC2[84 aa] A 92.3
/95.4		 13
/13		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7o35[3] E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		C 100.0
/95.5		 4
/4		 NCAP_SARS2 Nucleoprotein
7o35[3] E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		D 100.0
/95.4		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz[1] G GKP
(2R,3R)-2,3-bis{[(2E)-3-(3,4-dihydroxyphenyl)prop-.. 		A 100.0
/95.4		 8
/8		 NCAP_SARS2 Nucleoprotein
7xxk[3] H 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		A 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk[3] I 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		A 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk[1] R GUN
GUANINE[11 atoms] 		C 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk[1] R GUN
GUANINE[11 atoms] 		D 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk[1] FA GMP
GUANOSINE[20 atoms] 		E 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk[1] FA GMP
GUANOSINE[20 atoms] 		F 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7n0i[1] N MG
MAGNESIUM ION[1 atoms] 		D 100.0
/95.8		 3
/3		 NCAP_SARS2 Nucleoprotein
6wji[6] G CL
CHLORIDE ION[1 atoms] 		A 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji[4] H CL
CHLORIDE ION[1 atoms] 		A 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji[9] K CL
CHLORIDE ION[1 atoms] 		D 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2b[1] E CL
CHLORIDE ION[1 atoms] 		B 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7uxz[1] L CL
CHLORIDE ION[1 atoms] 		E 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk[1] O CL
CHLORIDE ION[1 atoms] 		B 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk[1] P CL
CHLORIDE ION[1 atoms] 		B 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7xxk[1] V CL
CHLORIDE ION[1 atoms] 		C 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk[1] X CL
CHLORIDE ION[1 atoms] 		C 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk[2] Y CL
CHLORIDE ION[1 atoms] 		C 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk[1] EA CL
CHLORIDE ION[1 atoms] 		E 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk[1] IA CL
CHLORIDE ION[1 atoms] 		F 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7uxz[3] J NA
SODIUM ION[1 atoms] 		A 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk[5] J K
POTASSIUM ION[1 atoms] 		A 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk[2] K K
POTASSIUM ION[1 atoms] 		A 66.7
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk[1] L K
POTASSIUM ION[1 atoms] 		A 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7xxk[1] M K
POTASSIUM ION[1 atoms] 		A 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7xxk[5] N K
POTASSIUM ION[1 atoms] 		A 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2cjr[114] B NCAP_CVHSA NUCLEOCAPSID PROTEIN[113 aa] A 100.0
/100.0		 52
/52		 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/100.0		 8
/8		 NCAP_CVHSA Nucleocapsid protein
2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/100.0		 6
/6		 NCAP_CVHSA Nucleocapsid protein
2gib[2] B NCAP_CVHSA Nucleocapsid protein[96 aa] A 100.0
/100.0		 1
/1		 NCAP_CVHSA Nucleocapsid protein
2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] B 100.0
/100.0		 3
/3		 NCAP_CVHSA Nucleocapsid protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
422 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2ofz[1] B EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_CVHSA Nucleocapsid protein
7f2b[2] C PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7f2b[2] D PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/95.3		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2b[1] F PO4
PHOSPHATE ION[5 atoms] 		B 80.0
/95.3		 5
/5		 NCAP_SARS2 Nucleoprotein
7f2b[1] H PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2e[4] M PO4
PHOSPHATE ION[5 atoms] 		G 100.0
/95.3		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2e[4] M PO4
PHOSPHATE ION[5 atoms] 		H 100.0
/95.3		 1
/1		 NCAP_SARS2 Nucleoprotein
7xwx[3] I PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/96.0		 2
/2		 NCAP_SARS2 Nucleoprotein
2gib[5] C SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_CVHSA Nucleocapsid protein
6wzq[5] E SO4
SULFATE ION[5 atoms] 		A 100.0
/95.6		 2
/2		 NCAP_SARS2 Nucleoprotein
6wzq[1] F SO4
SULFATE ION[5 atoms] 		A 100.0
/95.6		 1
/1		 NCAP_SARS2 Nucleoprotein
6wzq[3] G SO4
SULFATE ION[5 atoms] 		B 100.0
/95.6		 1
/1		 NCAP_SARS2 Nucleoprotein
6wzq[1] I SO4
SULFATE ION[5 atoms] 		C 100.0
/95.7		 3
/3		 NCAP_SARS2 Nucleoprotein
7c22[2] E ACT
ACETATE ION[4 atoms] 		A 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7c22[2] E ACT
ACETATE ION[4 atoms] 		B 100.0
/95.6		 1
/1		 NCAP_SARS2 Nucleoprotein
7n0i[1] M ACT
ACETATE ION[4 atoms] 		C 100.0
/95.8		 3
/3		 NCAP_SARS2 Nucleoprotein
7n0i[1] M ACT
ACETATE ION[4 atoms] 		D 100.0
/95.8		 2
/2		 NCAP_SARS2 Nucleoprotein
7n0i[1] O ACT
ACETATE ION[4 atoms] 		L 100.0
/95.8		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxx[1] I ACT
ACETATE ION[4 atoms] 		B 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7uxx[1] I ACT
ACETATE ION[4 atoms] 		D 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7c22[1] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/95.4		 3
/3		 NCAP_SARS2 Nucleoprotein
7de1[1] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/95.7		 5
/5		 NCAP_SARS2 Nucleoprotein
7de1[2] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/95.7		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxz[2] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/95.4		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz[1] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7o36[1] F GOL
GLYCEROL[6 atoms] 		A 100.0
/95.5		 3
/3		 NCAP_SARS2 Nucleoprotein
7o36[1] F GOL
GLYCEROL[6 atoms] 		B 100.0
/95.4		 9
/9		 NCAP_SARS2 Nucleoprotein
7uxx[1] G GOL
GLYCEROL[6 atoms] 		A 100.0
/95.4		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxx[4] H GOL
GLYCEROL[6 atoms] 		B 100.0
/95.4		 1
/1		 NCAP_SARS2 Nucleoprotein
7uxx[1] G GOL
GLYCEROL[6 atoms] 		C 100.0
/95.4		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxx[3] J GOL
GLYCEROL[6 atoms] 		F 75.0
/95.5		 4
/4		 NCAP_SARS2 Nucleoprotein
7xxk[1] G SCN
THIOCYANATE ION[3 atoms] 		A 100.0
/95.4		 5
/5		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.