HOMCOS(prot_sch_conbars.cgi):

#WARNING:no index is registered index "YP_009725311.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725311.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

863929

298

YP_009725311.1()

QUERYSEQ

SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFF
TYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725311.1()]

298
	region	name	description
	1-298	DISORDER	predicted by DISOPRED

MONOMER

298

pdb_id a¹ identity[%]² description

8ov3 A 100.0 R1AB_SARS2 2'-O-methyltransferase nsp16

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

298 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2xyq[48] B R1AB_CVHSA NON-STRUCTURAL PROTEIN 10[122 aa] A 100.0
/93.7 21
/21 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

3r24[1] B R1A_CVHSA Non-structural protein 10 and Non-structural prote.. A 100.0
/93.5 21
/21 R1AB_CVHSA 2'-O-methyl transferase

7nh7[1] B R1A_CVHOC Replicase polyprotein 1a[120 aa] A 73.1
/66.1 26
/26 R1AB_CVHOC Replicase polyprotein 1ab

5yn5[12] B K4LC41_9BETC nsp10 protein[124 aa] A 62.5
/65.4 24
/24 K0BWD0_9BETC nsp16 protein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

298 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7jyy[2] E RNA (5'-D(*(M7G))-R(P*AP*UP*UP*A)-3') A 100.0
/100.0 26
/26 R1AB_SARS2 2'-O-methyltransferase

7jz0[1] E RNA (5'-D(*(M7G))-R(P*(A2M)P*UP*U)-3') A 100.0
/100.0 26
/26 R1AB_SARS2 2'-O-methyltransferase

7jz0[2] F RNA (5'-D(*(M7G))-R(P*(A2M)P*UP*U)-3') C 100.0
/100.0 26
/26 R1AB_SARS2 2'-O-methyltransferase

7l6r[1] C RNA (5'-D(*(M7G))-R(P*(A2M)P*UP*UP*AP*A)-3') A 100.0
/100.0 26
/26 R1AB_SARS2 2'-O-methyltransferase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

298 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3r24[1] C SAM
S-ADENOSYLMETHIONINE[27 atoms] A 100.0
/93.5 19
/19 R1AB_CVHSA 2'-O-methyl transferase

5yn6[17] C SAM
S-ADENOSYLMETHIONINE[27 atoms] A 94.4
/66.1 18
/18 K0BWD0_9BETC nsp16 protein

7c2i[2] C SAM
S-ADENOSYLMETHIONINE[27 atoms] A 100.0
/100.0 18
/18 R1AB_SARS2 2'-O-methyltransferase

5ynf[12] C GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA.. A 89.5
/65.9 19
/19 K0BWD0_9BETC nsp16 protein

7koa[1] E GTA
P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA.. A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase

6w4h[1] G BDF
beta-D-fructopyranose[12 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase

6w4h[1] J BDF
beta-D-fructopyranose[12 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

7l6r[2] N BDF
beta-D-fructopyranose[12 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

6wks[1] D ADN
ADENOSINE[19 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 2'-O-methyltransferase

6wq3[2] E 8NK
7-methylguanosine 5'-diphosphate [29 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase

6wrz[4] E MGP
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE[33 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase

6wvn[1] Q ADE
ADENINE[10 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

6wvn[1] R ADE
ADENINE[10 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

7jhe[1] E V9G
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-(2'-O-METHYL.. A 100.0
/100.0 18
/18 R1AB_SARS2 2'-O-methyltransferase

7l6r[2] I GLC
alpha-D-glucopyranose[12 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase

7l6r[2] J GLC
alpha-D-glucopyranose[12 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase

7l6r[1] K GLC
alpha-D-glucopyranose[12 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase

7l6r[1] L GLC
alpha-D-glucopyranose[12 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

7lw3[1] F YG4
[(2~{R},3~{R},4~{R},5~{R})-5-(6-azanyl-7,8-dihydro.. A 100.0
/100.0 15
/15 R1AB_SARS2 2'-O-methyltransferase

7r1t[1] C 6NR
(2~{S})-2-azanyl-4-[[(2~{S},3~{S},4~{R},5~{R})-5-(.. A 100.0
/100.0 19
/19 R1AB_SARS2 2'-O-methyltransferase nsp16

7r1u[1] C 4IK
(2S,5S)-2,6-diamino-5-{[(2R,3S,4R,5R)-5-(6-amino-9.. A 100.0
/100.0 18
/18 R1AB_SARS2 2'-O-methyltransferase nsp16

8a23[1] C KW6
(2R,3R,4S,5R)-2-[4-azanyl-5-(2-quinolin-3-ylethyny.. A 100.0
/100.0 14
/14 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[1] V TBN
'2-(4-AMINO-PYRROLO[2,3-D]PYRIMIDIN-7-YL)-5-HYDROX.. A 100.0
/100.0 12
/12 R1AB_SARS2 2'-O-methyltransferase nsp16

8osx[1] C ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] A 100.0
/100.0 16
/16 R1AB_SARS2 2'-O-methyltransferase nsp16

8ov2[1] X SGV
SANGIVAMYCIN[22 atoms] A 100.0
/100.0 13
/13 R1AB_SARS2 2'-O-methyltransferase nsp16

8ov3[1] T 5ID
(2R,3R,4S,5R)-2-(4-AMINO-5-IODO-7H-PYRROLO[2,3-D]P.. A 100.0
/100.0 13
/13 R1AB_SARS2 2'-O-methyltransferase nsp16

8ov4[1] V TO1
4-amino-7-(beta-D-ribofuranosyl)-7H-pyrrolo[2,3-d].. A 100.0
/100.0 13
/13 R1AB_SARS2 2'-O-methyltransferase nsp16

2xyq[7] E SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] A 100.0
/93.7 17
/17 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

6wjt[9] F SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] A 100.0
/100.0 18
/18 R1AB_SARS2 2'-O-methyltransferase

2xyr[6] H SFG
SINEFUNGIN[27 atoms] A 100.0
/94.1 17
/17 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

6wkq[2] G SFG
SINEFUNGIN[27 atoms] A 100.0
/100.0 17
/17 R1AB_SARS2 2'-O-methyltransferase

5yni[4] D GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52.. A 87.5
/66.3 16
/16 K0BWD0_9BETC nsp16 protein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

298 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2xyq[3] C CL
CHLORIDE ION[1 atoms] A 100.0
/93.7 1
/1 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

2xyq[3] D CL
CHLORIDE ION[1 atoms] A 100.0
/93.7 3
/3 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

2xyr[1] E CL
CHLORIDE ION[1 atoms] A 100.0
/94.1 4
/4 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

2xyr[6] F CL
CHLORIDE ION[1 atoms] A 66.7
/94.1 3
/3 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

2xyv[2] I CL
CHLORIDE ION[1 atoms] A 100.0
/94.4 2
/2 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

6w61[1] C CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

6wrz[6] N CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

6wrz[1] P CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

6wvn[1] C CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

6wvn[1] D CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

6wvn[2] DA CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

6wvn[2] G CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

6wvn[1] H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

6wvn[1] I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

6wvn[1] J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

6wvn[1] K CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

6wvn[1] L CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

6xkm[1] C CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

7jhe[3] C CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

7jib[1] D CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase

7jyy[2] J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/4 R1AB_SARS2 2'-O-methyltransferase

7jz0[1] AA CL
CHLORIDE ION[1 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

7jz0[1] Y CL
CHLORIDE ION[1 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

7jz0[1] Z CL
CHLORIDE ION[1 atoms] C 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

7l6t[1] E CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

8bsd[1] FA CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase nsp16

2xyq[3] F NA
SODIUM ION[1 atoms] A 100.0
/93.7 1
/1 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

2xyq[2] G NA
SODIUM ION[1 atoms] A 100.0
/93.7 6
/6 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

2xyv[1] E NA
SODIUM ION[1 atoms] A 100.0
/94.4 4
/4 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

6w75[12] E NA
SODIUM ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

6w75[1] T NA
SODIUM ION[1 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

6w75[1] U NA
SODIUM ION[1 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

6w75[4] V NA
SODIUM ION[1 atoms] C 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

7jyy[1] S NA
SODIUM ION[1 atoms] C 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase

7jz0[2] H NA
SODIUM ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

7ult[1] F NA
SODIUM ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

7ult[1] R NA
SODIUM ION[1 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

2xyq[3] H MG
MAGNESIUM ION[1 atoms] A 0.0
/93.7 1
/1 R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE

7jyy[3] H MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

7l6t[1] M MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

7lw3[1] D MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

7l6r[1] D MN
MANGANESE (II) ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

298 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6w4h[1] C SO3
SULFITE ION[4 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

6w61[69] D EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase

6w61[1] E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

7lw4[20] F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 3
/3 R1AB_SARS2 2'-O-methyltransferase

7lw4[9] I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 2'-O-methyltransferase

8bsd[6] AA EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[4] BA EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[12] C EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 8
/8 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[18] CA EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[11] G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[29] GA EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[11] H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[12] L EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[3] N EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[11] P EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[23] Q EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[5] S EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[6] T EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[8] U EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase nsp16

8bsd[5] Y EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase nsp16

8bzv[5] DA EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase nsp16

8c5m[1] BA EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase nsp16

8c5m[2] DA EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase nsp16

8c5m[4] U EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 2'-O-methyltransferase nsp16

8osx[2] Z EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase nsp16

8ot0[1] R EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase nsp16

8ov1[1] CA EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase nsp16

6w75[17] G FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase

6w75[21] J FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 2'-O-methyltransferase

6w75[4] K FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

6w75[3] L FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

6w75[8] M FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase

6w75[3] O FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase

6w75[4] AA FMT
FORMIC ACID[3 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

6w75[3] CA FMT
FORMIC ACID[3 atoms] C 100.0
/100.0 6
/6 R1AB_SARS2 2'-O-methyltransferase

6w75[1] KA FMT
FORMIC ACID[3 atoms] C 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

6wjt[1] K FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase

6wjt[1] L FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase

6wjt[1] P FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

6wjt[1] W FMT
FORMIC ACID[3 atoms] C 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase

6wkq[2] H FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

7jyy[1] N FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase

7jz0[2] L FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase

7jz0[1] N FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase

7jz0[1] CA FMT
FORMIC ACID[3 atoms] C 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase

7ult[1] L FMT
FORMIC ACID[3 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase

7ult[1] Z FMT
FORMIC ACID[3 atoms] C 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase

6wq3[4] F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

6wq3[4] G SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

6wq3[3] H SO4
SULFATE ION[5 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase

6wq3[6] I SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

6wq3[2] K SO4
SULFATE ION[5 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

6wrz[1] L SO4
SULFATE ION[5 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 2'-O-methyltransferase

6wrz[2] M SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 2'-O-methyltransferase

6wvn[1] Y SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase

6wvn[1] Z SO4
SULFATE ION[5 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 2'-O-methyltransferase

6yz1[16] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 nsp16

7r1t[1] D PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase nsp16

7r1t[1] E PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 2'-O-methyltransferase nsp16

8a23[1] D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase nsp16

6w4h[1] E ACT
ACETATE ION[4 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 2'-O-methyltransferase

6w4h[2] F ACT
ACETATE ION[4 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 2'-O-methyltransferase

7lw4[1] D ACT
ACETATE ION[4 atoms] A 100.0
/99.7 5
/5 R1AB_SARS2 2'-O-methyltransferase

7lw4[1] E ACT
ACETATE ION[4 atoms] A 100.0
/99.7 3
/3 R1AB_SARS2 2'-O-methyltransferase

7lw4[1] H ACT
ACETATE ION[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 2'-O-methyltransferase

7lw4[1] K ACT
ACETATE ION[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 2'-O-methyltransferase

7lw4[1] L ACT
ACETATE ION[4 atoms] A 100.0
/99.7 4
/4 R1AB_SARS2 2'-O-methyltransferase

7lw4[1] M ACT
ACETATE ION[4 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 2'-O-methyltransferase

7lw4[1] O ACT
ACETATE ION[4 atoms] A 100.0
/99.7 2
/2 R1AB_SARS2 2'-O-methyltransferase

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
298
	pdb_id	a¹	identity[%]²	description
	8ov3	A	100.0	R1AB_SARS2 2'-O-methyltransferase nsp16
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
298	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	2xyq[48]	B	R1AB_CVHSA NON-STRUCTURAL PROTEIN 10[122 aa]	A	100.0 /93.7	21 /21	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	3r24[1]	B	R1A_CVHSA Non-structural protein 10 and Non-structural prote..	A	100.0 /93.5	21 /21	R1AB_CVHSA 2'-O-methyl transferase
	7nh7[1]	B	R1A_CVHOC Replicase polyprotein 1a[120 aa]	A	73.1 /66.1	26 /26	R1AB_CVHOC Replicase polyprotein 1ab
	5yn5[12]	B	K4LC41_9BETC nsp10 protein[124 aa]	A	62.5 /65.4	24 /24	K0BWD0_9BETC nsp16 protein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
298	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7jyy[2]	E	RNA (5'-D((M7G))-R(PAPUPUP*A)-3')	A	100.0 /100.0	26 /26	R1AB_SARS2 2'-O-methyltransferase
	7jz0[1]	E	RNA (5'-D((M7G))-R(P(A2M)PUPU)-3')	A	100.0 /100.0	26 /26	R1AB_SARS2 2'-O-methyltransferase
	7jz0[2]	F	RNA (5'-D((M7G))-R(P(A2M)PUPU)-3')	C	100.0 /100.0	26 /26	R1AB_SARS2 2'-O-methyltransferase
	7l6r[1]	C	RNA (5'-D((M7G))-R(P(A2M)PUPUPAPA)-3')	A	100.0 /100.0	26 /26	R1AB_SARS2 2'-O-methyltransferase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
298	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3r24[1]	C	SAM S-ADENOSYLMETHIONINE[27 atoms]	A	100.0 /93.5	19 /19	R1AB_CVHSA 2'-O-methyl transferase
	5yn6[17]	C	SAM S-ADENOSYLMETHIONINE[27 atoms]	A	94.4 /66.1	18 /18	K0BWD0_9BETC nsp16 protein
	7c2i[2]	C	SAM S-ADENOSYLMETHIONINE[27 atoms]	A	100.0 /100.0	18 /18	R1AB_SARS2 2'-O-methyltransferase
	5ynf[12]	C	GTA P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..	A	89.5 /65.9	19 /19	K0BWD0_9BETC nsp16 protein
	7koa[1]	E	GTA P1-7-METHYLGUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHA..	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase
	6w4h[1]	G	BDF beta-D-fructopyranose[12 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase
	6w4h[1]	J	BDF beta-D-fructopyranose[12 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	7l6r[2]	N	BDF beta-D-fructopyranose[12 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	6wks[1]	D	ADN ADENOSINE[19 atoms]	A	100.0 /100.0	6 /6	R1AB_SARS2 2'-O-methyltransferase
	6wq3[2]	E	8NK 7-methylguanosine 5'-diphosphate [29 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase
	6wrz[4]	E	MGP 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE[33 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase
	6wvn[1]	Q	ADE ADENINE[10 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	6wvn[1]	R	ADE ADENINE[10 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	7jhe[1]	E	V9G 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-(2'-O-METHYL..	A	100.0 /100.0	18 /18	R1AB_SARS2 2'-O-methyltransferase
	7l6r[2]	I	GLC alpha-D-glucopyranose[12 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase
	7l6r[2]	J	GLC alpha-D-glucopyranose[12 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase
	7l6r[1]	K	GLC alpha-D-glucopyranose[12 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase
	7l6r[1]	L	GLC alpha-D-glucopyranose[12 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	7lw3[1]	F	YG4 [(2~{R},3~{R},4~{R},5~{R})-5-(6-azanyl-7,8-dihydro..	A	100.0 /100.0	15 /15	R1AB_SARS2 2'-O-methyltransferase
	7r1t[1]	C	6NR (2~{S})-2-azanyl-4-[[(2~{S},3~{S},4~{R},5~{R})-5-(..	A	100.0 /100.0	19 /19	R1AB_SARS2 2'-O-methyltransferase nsp16
	7r1u[1]	C	4IK (2S,5S)-2,6-diamino-5-{[(2R,3S,4R,5R)-5-(6-amino-9..	A	100.0 /100.0	18 /18	R1AB_SARS2 2'-O-methyltransferase nsp16
	8a23[1]	C	KW6 (2R,3R,4S,5R)-2-[4-azanyl-5-(2-quinolin-3-ylethyny..	A	100.0 /100.0	14 /14	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[1]	V	TBN '2-(4-AMINO-PYRROLO[2,3-D]PYRIMIDIN-7-YL)-5-HYDROX..	A	100.0 /100.0	12 /12	R1AB_SARS2 2'-O-methyltransferase nsp16
	8osx[1]	C	ATP ADENOSINE-5'-TRIPHOSPHATE[31 atoms]	A	100.0 /100.0	16 /16	R1AB_SARS2 2'-O-methyltransferase nsp16
	8ov2[1]	X	SGV SANGIVAMYCIN[22 atoms]	A	100.0 /100.0	13 /13	R1AB_SARS2 2'-O-methyltransferase nsp16
	8ov3[1]	T	5ID (2R,3R,4S,5R)-2-(4-AMINO-5-IODO-7H-PYRROLO[2,3-D]P..	A	100.0 /100.0	13 /13	R1AB_SARS2 2'-O-methyltransferase nsp16
	8ov4[1]	V	TO1 4-amino-7-(beta-D-ribofuranosyl)-7H-pyrrolo[2,3-d]..	A	100.0 /100.0	13 /13	R1AB_SARS2 2'-O-methyltransferase nsp16
	2xyq[7]	E	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	A	100.0 /93.7	17 /17	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	6wjt[9]	F	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	A	100.0 /100.0	18 /18	R1AB_SARS2 2'-O-methyltransferase
	2xyr[6]	H	SFG SINEFUNGIN[27 atoms]	A	100.0 /94.1	17 /17	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	6wkq[2]	G	SFG SINEFUNGIN[27 atoms]	A	100.0 /100.0	17 /17	R1AB_SARS2 2'-O-methyltransferase
	5yni[4]	D	GTG 7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52..	A	87.5 /66.3	16 /16	K0BWD0_9BETC nsp16 protein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
298	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	2xyq[3]	C	CL CHLORIDE ION[1 atoms]	A	100.0 /93.7	1 /1	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	2xyq[3]	D	CL CHLORIDE ION[1 atoms]	A	100.0 /93.7	3 /3	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	2xyr[1]	E	CL CHLORIDE ION[1 atoms]	A	100.0 /94.1	4 /4	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	2xyr[6]	F	CL CHLORIDE ION[1 atoms]	A	66.7 /94.1	3 /3	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	2xyv[2]	I	CL CHLORIDE ION[1 atoms]	A	100.0 /94.4	2 /2	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	6w61[1]	C	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	6wrz[6]	N	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	6wrz[1]	P	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	6wvn[1]	C	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	6wvn[1]	D	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	6wvn[2]	DA	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	6wvn[2]	G	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	6wvn[1]	H	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	6wvn[1]	I	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	6wvn[1]	J	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	6wvn[1]	K	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	6wvn[1]	L	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	6xkm[1]	C	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	7jhe[3]	C	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	7jib[1]	D	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase
	7jyy[2]	J	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	3 /4	R1AB_SARS2 2'-O-methyltransferase
	7jz0[1]	AA	CL CHLORIDE ION[1 atoms]	C	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	7jz0[1]	Y	CL CHLORIDE ION[1 atoms]	C	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	7jz0[1]	Z	CL CHLORIDE ION[1 atoms]	C	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	7l6t[1]	E	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	8bsd[1]	FA	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase nsp16
	2xyq[3]	F	NA SODIUM ION[1 atoms]	A	100.0 /93.7	1 /1	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	2xyq[2]	G	NA SODIUM ION[1 atoms]	A	100.0 /93.7	6 /6	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	2xyv[1]	E	NA SODIUM ION[1 atoms]	A	100.0 /94.4	4 /4	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	6w75[12]	E	NA SODIUM ION[1 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	6w75[1]	T	NA SODIUM ION[1 atoms]	C	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	6w75[1]	U	NA SODIUM ION[1 atoms]	C	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	6w75[4]	V	NA SODIUM ION[1 atoms]	C	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	7jyy[1]	S	NA SODIUM ION[1 atoms]	C	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase
	7jz0[2]	H	NA SODIUM ION[1 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	7ult[1]	F	NA SODIUM ION[1 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	7ult[1]	R	NA SODIUM ION[1 atoms]	C	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	2xyq[3]	H	MG MAGNESIUM ION[1 atoms]	A	0.0 /93.7	1 /1	R1AB_CVHSA PUTATIVE 2'-O-METHYL TRANSFERASE
	7jyy[3]	H	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	7l6t[1]	M	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	7lw3[1]	D	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	7l6r[1]	D	MN MANGANESE (II) ION[1 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
298	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6w4h[1]	C	SO3 SULFITE ION[4 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	6w61[69]	D	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase
	6w61[1]	E	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	7lw4[20]	F	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	3 /3	R1AB_SARS2 2'-O-methyltransferase
	7lw4[9]	I	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.7	2 /2	R1AB_SARS2 2'-O-methyltransferase
	8bsd[6]	AA	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[4]	BA	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[12]	C	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	8 /8	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[18]	CA	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[11]	G	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[29]	GA	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[11]	H	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[12]	L	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[3]	N	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[11]	P	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[23]	Q	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	6 /6	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[5]	S	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[6]	T	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[8]	U	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bsd[5]	Y	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase nsp16
	8bzv[5]	DA	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase nsp16
	8c5m[1]	BA	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase nsp16
	8c5m[2]	DA	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase nsp16
	8c5m[4]	U	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	6 /6	R1AB_SARS2 2'-O-methyltransferase nsp16
	8osx[2]	Z	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase nsp16
	8ot0[1]	R	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase nsp16
	8ov1[1]	CA	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase nsp16
	6w75[17]	G	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase
	6w75[21]	J	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	6 /6	R1AB_SARS2 2'-O-methyltransferase
	6w75[4]	K	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	6w75[3]	L	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	6w75[8]	M	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase
	6w75[3]	O	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase
	6w75[4]	AA	FMT FORMIC ACID[3 atoms]	C	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	6w75[3]	CA	FMT FORMIC ACID[3 atoms]	C	100.0 /100.0	6 /6	R1AB_SARS2 2'-O-methyltransferase
	6w75[1]	KA	FMT FORMIC ACID[3 atoms]	C	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	6wjt[1]	K	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase
	6wjt[1]	L	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase
	6wjt[1]	P	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	6wjt[1]	W	FMT FORMIC ACID[3 atoms]	C	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase
	6wkq[2]	H	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	7jyy[1]	N	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase
	7jz0[2]	L	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase
	7jz0[1]	N	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase
	7jz0[1]	CA	FMT FORMIC ACID[3 atoms]	C	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase
	7ult[1]	L	FMT FORMIC ACID[3 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase
	7ult[1]	Z	FMT FORMIC ACID[3 atoms]	C	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase
	6wq3[4]	F	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	6wq3[4]	G	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	6wq3[3]	H	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase
	6wq3[6]	I	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	6wq3[2]	K	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	6wrz[1]	L	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	1 /1	R1AB_SARS2 2'-O-methyltransferase
	6wrz[2]	M	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	3 /3	R1AB_SARS2 2'-O-methyltransferase
	6wvn[1]	Y	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase
	6wvn[1]	Z	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	4 /4	R1AB_SARS2 2'-O-methyltransferase
	6yz1[16]	D	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 nsp16
	7r1t[1]	D	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase nsp16
	7r1t[1]	E	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /100.0	2 /2	R1AB_SARS2 2'-O-methyltransferase nsp16
	8a23[1]	D	GOL GLYCEROL[6 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase nsp16
	6w4h[1]	E	ACT ACETATE ION[4 atoms]	A	100.0 /100.0	5 /5	R1AB_SARS2 2'-O-methyltransferase
	6w4h[2]	F	ACT ACETATE ION[4 atoms]	A	100.0 /100.0	7 /7	R1AB_SARS2 2'-O-methyltransferase
	7lw4[1]	D	ACT ACETATE ION[4 atoms]	A	100.0 /99.7	5 /5	R1AB_SARS2 2'-O-methyltransferase
	7lw4[1]	E	ACT ACETATE ION[4 atoms]	A	100.0 /99.7	3 /3	R1AB_SARS2 2'-O-methyltransferase
	7lw4[1]	H	ACT ACETATE ION[4 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 2'-O-methyltransferase
	7lw4[1]	K	ACT ACETATE ION[4 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 2'-O-methyltransferase
	7lw4[1]	L	ACT ACETATE ION[4 atoms]	A	100.0 /99.7	4 /4	R1AB_SARS2 2'-O-methyltransferase
	7lw4[1]	M	ACT ACETATE ION[4 atoms]	A	100.0 /99.7	2 /2	R1AB_SARS2 2'-O-methyltransferase
	7lw4[1]	O	ACT ACETATE ION[4 atoms]	A	100.0 /99.7	2 /2	R1AB_SARS2 2'-O-methyltransferase
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [YP_009725311.1()]