#WARNING:no index is registered index "YP_009725310.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725310.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1678207 346 163 YP_009725310.1()
QUERYSEQ 
SLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKG
LQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLD
DFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725310.1()]

346
region name description
1-1 DISORDER predicted by DISOPRED

MONOMER
346
pdb_id a1 identity[%]2 description
5s72 B 100.0 R1AB_SARS2 Uridylate-specific endoribonuclease 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
NUCLEOTIDE
346 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6x1b[6] C DNA (5'-R(*GP*U)-3') A 100.0
/100.0		 11
/11		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n06[6] G RNA (5'-R(*AP*UP*A)-3') A 100.0
/100.0		 10
/10		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n06[3] H RNA (5'-R(*AP*UP*A)-3') A 100.0
/100.0		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n33[6] G RNA (5'-R(*A)-D(*(UFT))-R(P*A)-3') A 100.0
/100.0		 11
/11		 R1AB_SARS2 Uridylate-specific endoribonuclease
7tj2[1] G RNA (31-MER) A 100.0
/99.7		 11
/11		 R1AB_SARS2 Uridylate-specific endoribonuclease nsp15
7tj2[1] G RNA (31-MER) C 100.0
/99.7		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease nsp15
7tj2[1] G RNA (31-MER) E 100.0
/99.7		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease nsp15
7tj2[1] H RNA (31-MER) A 100.0
/99.7		 6
/6		 R1AB_SARS2 Uridylate-specific endoribonuclease nsp15
7tj2[1] H RNA (31-MER) C 100.0
/99.7		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease nsp15
7tj2[1] H RNA (31-MER) E 100.0
/99.7		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease nsp15
7tqv[1] G RNA (33-MER) A 100.0
/99.7		 11
/11		 R1AB_SARS2 Uridylate-specific endoribonuclease
7tqv[1] G RNA (33-MER) C 100.0
/99.7		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
7tqv[1] G RNA (33-MER) E 100.0
/99.7		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
7tqv[1] H RNA (33-MER) A 100.0
/99.7		 6
/6		 R1AB_SARS2 Uridylate-specific endoribonuclease
7tqv[1] H RNA (33-MER) C 100.0
/99.7		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease
7tqv[1] H RNA (33-MER) E 100.0
/99.7		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
346 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5s6x[6] D WUG
1-(2,4-dimethyl-1H-imidazol-5-yl)methanamine[9 ato.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s6y[3] D WUJ
N-[(furan-2-yl)methyl]urea[10 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s6y[3] F WUJ
N-[(furan-2-yl)methyl]urea[10 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s6z[6] D WUM
4-[(dimethylamino)methyl]-1,3-thiazol-2-amine[10 a.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s70[3] E WUS
(5R)-2-methyl-4,5,6,7-tetrahydro-1H-benzimidazol-5.. 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s71[6] D WUV
5'-thiothymidine[17 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s71[6] D WUV
5'-thiothymidine[17 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s72[3] D WUY
N-(2-aminoethyl)-N'-phenylurea[13 atoms] 		A 100.0
/100.0		 10
/10		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s72[3] D WUY
N-(2-aminoethyl)-N'-phenylurea[13 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sa4[3] C K3A
N-(5-methyl-1H-pyrazol-3-yl)acetamide[10 atoms] 		B 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sa5[3] E ZQA
4-ethyl-2-(1H-imidazol-5-yl)-1,3-thiazole[12 atoms.. 		B 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sa6[6] C O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sa6[6] C O3G
N-benzyl-1-(4-fluorophenyl)methanamine[16 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sa7[6] C WL7
4-amino-N-(2-hydroxyethyl)-N-methylbenzene-1-sulfo.. 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sa8[6] C JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sa8[3] C JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sa8[3] D JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid.. 		B 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sa9[3] C GWG
1-methylindazole-3-carboxamide[13 atoms] 		B 100.0
/100.0		 9
/9		 R1AB_SARS2 Uridylate-specific endoribonuclease
5saa[6] D ZQD
3-[(2S)-1-(methanesulfonyl)pyrrolidin-2-yl]-5-meth.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sab[3] E WJD
2-methoxy-N-phenylacetamide[12 atoms] 		B 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sac[3] E VWG
N-hydroxyquinoline-2-carboxamide[14 atoms] 		B 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sad[3] C EJW
(3-phenyl-1,2-oxazol-5-yl)methylazanium[13 atoms] 		B 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sae[6] D W3G
pyridazin-3(2H)-one[7 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
5saf[6] D WOY
6,7-dihydro-5H-pyrrolo[2,3-d]pyrimidine[9 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sag[3] C ZQG
3-(1H-imidazol-2-yl)propan-1-amine[9 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sag[3] C ZQG
3-(1H-imidazol-2-yl)propan-1-amine[9 atoms] 		B 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sah[3] C ZQJ
2-methyl-5,6,7,8-tetrahydropyrido[4,3-c]pyridazin-.. 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sah[3] D ZQJ
2-methyl-5,6,7,8-tetrahydropyrido[4,3-c]pyridazin-.. 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
5sai[3] C ZQM
N-{2-[(propan-2-yl)sulfanyl]phenyl}urea[14 atoms] 		B 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[6] C U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Uridylate-specific endoribonuclease
7k0r[6] G U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[6] C CMU
5-CHLORO-6-(1-(2-IMINOPYRROLIDINYL) METHYL) URACIL.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[6] C U3P
3'-URIDINEMONOPHOSPHATE[21 atoms] 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Uridylate-specific endoribonuclease
7k1l[6] C UVC
URIDINE-2',3'-VANADATE[21 atoms] 		A 100.0
/100.0		 13
/13		 R1AB_SARS2 Uridylate-specific endoribonuclease
7k1o[6] D VQV
1-(3,5-di-O-phosphono-alpha-L-xylofuranosyl)pyrimi.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Uridylate-specific endoribonuclease
7keh[6] C B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR.. 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
7keh[3] E B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR.. 		B 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n7r[3] C S6V
1-[2-(2-oxidanylidenepyrrolidin-1-yl)ethyl]-3-phen.. 		B 100.0
/100.0		 9
/9		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n7u[6] C 0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n7u[6] C 0MI
1-[(2~{R},4~{S},5~{R})-5-[[(azanylidene-$l^{4}-aza.. 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n7w[3] C 0OI
N-(2-fluorophenyl)-N'-methylurea[12 atoms] 		B 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n7y[6] C RZG
methyl 4-sulfamoylbenzoate[14 atoms] 		A 100.0
/100.0		 14
/14		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n83[6] D WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n83[6] D WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n83[6] E WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n83[6] E WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n83[6] F WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n83[3] G WNM
(3S)-1-(phenylsulfonyl)pyrrolidin-3-amine[15 atoms.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Uridylate-specific endoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
346 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6vww[3] E MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] L CL
CHLORIDE ION[1 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[3] P NA
SODIUM ION[1 atoms] 		B 100.0
/100.0		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
346 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5s6x[293] A R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] A 100.0
/100.0		 27
/27		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s6x[203] A R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] A 100.0
/100.0		 27
/27		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s6x[281] B R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] A 100.0
/100.0		 14
/15		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s6y[30] B R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[54] A R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] A 100.0
/100.0		 26
/26		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[12] B R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
7k0r[18] C R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] A 100.0
/100.0		 20
/20		 R1AB_SARS2 Uridylate-specific endoribonuclease
7k0r[4] F R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
7k9p[12] B R1AB_SARS2 Uridylate-specific endoribonuclease[349 aa] A 100.0
/100.0		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease
7me0[6] C R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
7me0[12] E R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] A 100.0
/100.0		 25
/25		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n06[6] B R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] A 100.0
/100.0		 24
/24		 R1AB_SARS2 Uridylate-specific endoribonuclease
7n06[6] C R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] A 100.0
/100.0		 23
/23		 R1AB_SARS2 Uridylate-specific endoribonuclease
8d34[6] B R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[348 aa] A 100.0
/99.7		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease nsp15
7tj2[1] D R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[271 aa] A 100.0
/99.7		 12
/14		 R1AB_SARS2 Uridylate-specific endoribonuclease nsp15
7tj2[1] D R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[271 aa] E 100.0
/99.7		 21
/21		 R1AB_SARS2 Uridylate-specific endoribonuclease nsp15
7tj2[1] D R1AB_SARS2 Uridylate-specific endoribonuclease nsp15[271 aa] F 100.0
/99.7		 25
/25		 R1AB_SARS2 Uridylate-specific endoribonuclease nsp15
2h85[12] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 85.7
/88.1		 28
/28		 Q6VA80_CVHSA Putative orf1ab polyprotein
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 85.2
/88.1		 27
/27		 Q6VA80_CVHSA Putative orf1ab polyprotein
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 92.9
/88.1		 14
/16		 Q6VA80_CVHSA Putative orf1ab polyprotein
2ozk[2] B R1AB_CVHSA Uridylate-specific endoribonuclease[305 aa] A 86.7
/88.6		 30
/30		 R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[4] C R1AB_CVHSA Uridylate-specific endoribonuclease[291 aa] A 81.8
/88.6		 11
/11		 R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[2] D R1AB_CVHSA Uridylate-specific endoribonuclease[296 aa] A 66.7
/88.6		 3
/3		 R1AB_CVHSA Uridylate-specific endoribonuclease
2ozk[2] A R1AB_CVHSA Uridylate-specific endoribonuclease[306 aa] C 85.7
/88.3		 14
/14		 R1AB_CVHSA Uridylate-specific endoribonuclease
2rhb[6] B R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] A 88.0
/88.4		 25
/25		 R1AB_CVHSA Uridylate-specific endoribonuclease
2rhb[6] E R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] A 93.8
/88.4		 16
/17		 R1AB_CVHSA Uridylate-specific endoribonuclease
5yvd[6] A A0A0U2GPI9_9BETC Nsp15[341 aa] A 41.4
/51.9		 29
/29		 A0A0U2GPI9_9BETC Nsp15
5yvd[6] A A0A0U2GPI9_9BETC Nsp15[341 aa] A 40.0
/51.9		 25
/25		 A0A0U2GPI9_9BETC Nsp15
5yvd[6] B A0A0U2GPI9_9BETC Nsp15[341 aa] A 61.5
/51.9		 13
/14		 A0A0U2GPI9_9BETC Nsp15
5yvd[6] B A0A0U2GPI9_9BETC Nsp15[341 aa] A 25.0
/51.9		 4
/4		 A0A0U2GPI9_9BETC Nsp15
5yvd[6] B A0A0U2GPI9_9BETC Nsp15[341 aa] A 100.0
/51.9		 1
/1		 A0A0U2GPI9_9BETC Nsp15
2gth[12] A R1AB_CVMA5 Replicase polyprotein 1ab[348 aa] A 33.3
/49.5		 24
/24		 R1AB_CVMA5 Replicase polyprotein 1ab
2gth[12] A R1AB_CVMA5 Replicase polyprotein 1ab[348 aa] A 47.8
/49.5		 23
/24		 R1AB_CVMA5 Replicase polyprotein 1ab
2gth[12] A R1AB_CVMA5 Replicase polyprotein 1ab[348 aa] A 57.9
/49.5		 19
/20		 R1AB_CVMA5 Replicase polyprotein 1ab
2gth[12] A R1AB_CVMA5 Replicase polyprotein 1ab[348 aa] A 37.5
/49.5		 8
/8		 R1AB_CVMA5 Replicase polyprotein 1ab
4rs4[18] B R1AB_CVH22 Uridylate-specific endoribonuclease[345 aa] A 60.0
/45.3		 15
/17		 R1AB_CVH22 Uridylate-specific endoribonuclease
4rs4[18] C R1AB_CVH22 Uridylate-specific endoribonuclease[332 aa] A 44.4
/45.3		 18
/21		 R1AB_CVH22 Uridylate-specific endoribonuclease
4rs4[18] D R1AB_CVH22 Uridylate-specific endoribonuclease[337 aa] A 33.3
/45.3		 27
/27		 R1AB_CVH22 Uridylate-specific endoribonuclease
4rs4[18] F R1AB_CVH22 Uridylate-specific endoribonuclease[346 aa] A 16.7
/45.3		 6
/6		 R1AB_CVH22 Uridylate-specific endoribonuclease
5da1[1] B E3V2B6_PRRSV endoribonuclease[205 aa] A 18.8
/30.1		 16
/16		 E3V2B6_PRRSV endoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
346 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2gti[6] C SO4
SULFATE ION[5 atoms] 		A 60.0
/49.2		 5
/5		 R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] D SO4
SULFATE ION[5 atoms] 		A 20.0
/49.2		 5
/5		 R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] E SO4
SULFATE ION[5 atoms] 		A 0.0
/49.2		 3
/3		 R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] G SO4
SULFATE ION[5 atoms] 		A 50.0
/49.2		 2
/2		 R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] H SO4
SULFATE ION[5 atoms] 		A 50.0
/49.2		 2
/3		 R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] I SO4
SULFATE ION[5 atoms] 		A 33.3
/49.2		 3
/3		 R1AB_CVMA5 Replicase polyprotein 1ab
6wlc[3] L SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
7k1l[6] G SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
7keh[6] D SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
2gti[6] J GOL
GLYCEROL[6 atoms] 		A 60.0
/49.2		 5
/5		 R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] K GOL
GLYCEROL[6 atoms] 		A 0.0
/49.2		 1
/1		 R1AB_CVMA5 Replicase polyprotein 1ab
2gti[6] K GOL
GLYCEROL[6 atoms] 		A 25.0
/49.2		 4
/4		 R1AB_CVMA5 Replicase polyprotein 1ab
5yvd[6] C GOL
GLYCEROL[6 atoms] 		A 100.0
/51.9		 6
/6		 A0A0U2GPI9_9BETC Nsp15
6vww[6] C GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] C GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] D GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[6] F GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[6] G GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] I GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] N GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
4s1t[18] G PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/45.0		 5
/5		 R1AB_CVH22 Uridylate-specific endoribonuclease
6wxc[12] D PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
7k0r[6] H PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Uridylate-specific endoribonuclease
5s6x[96] C CIT
CITRIC ACID[13 atoms] 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[12] N CIT
CITRIC ACID[13 atoms] 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] H ACY
ACETIC ACID[4 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] O ACY
ACETIC ACID[4 atoms] 		B 100.0
/100.0		 6
/6		 R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] P ACY
ACETIC ACID[4 atoms] 		B 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[24] C EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[18] D EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[6] E EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[12] F EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[15] I EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[6] J EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[6] K EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] L EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] M EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[9] O EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[12] P EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[18] R EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[15] BA EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[21] CA EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] S EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[9] T EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] V EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 6
/6		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] J EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[12] K EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[3] H EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
6x1b[3] G EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
6x1b[3] H EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[12] D EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[3] G EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[3] G EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[6] I EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[3] X EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
7k1l[3] F EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
7k1l[3] F EDO
1,2-ETHANEDIOL[4 atoms] 		B 100.0
/100.0		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[6] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[6] D TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] N TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] 		B 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] F ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] Q ACT
ACETATE ION[4 atoms] 		B 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] S ACT
ACETATE ION[4 atoms] 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] T ACT
ACETATE ION[4 atoms] 		B 100.0
/100.0		 7
/7		 R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[6] C ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[6] C ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[3] K ACT
ACETATE ION[4 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
7k1l[3] E ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] U FMT
FORMIC ACID[3 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] U FMT
FORMIC ACID[3 atoms] 		B 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] V FMT
FORMIC ACID[3 atoms] 		B 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[6] K FMT
FORMIC ACID[3 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[3] K FMT
FORMIC ACID[3 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[3] P FMT
FORMIC ACID[3 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[6] Q FMT
FORMIC ACID[3 atoms] 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[3] F FMT
FORMIC ACID[3 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[3] G FMT
FORMIC ACID[3 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[3] I FMT
FORMIC ACID[3 atoms] 		B 100.0
/100.0		 5
/5		 R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[3] M FMT
FORMIC ACID[3 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Uridylate-specific endoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.