#WARNING:no index is registered index "YP_009725309.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725309.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
885291 527 91 YP_009725309.1()
QUERYSEQ 
AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLI
PLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG
DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDS
PCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725309.1()]

527
region name description
1-10 DISORDER predicted by DISOPRED

MONOMER
527
pdb_id a1 identity[%]2 description
7egq P 100.0 R1AB_SARS2 Proofreading exoribonuclease 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7egq[3] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] H 100.0
/100.0		 2
/2		 R1AB_SARS2 Proofreading exoribonuclease
7egq[2] I R1AB_SARS2 RNA-directed RNA polymerase[926 aa] H 100.0
/100.0		 17
/17		 R1AB_SARS2 Proofreading exoribonuclease
7egq[3] F R1AB_SARS2 Non-structural protein 9[113 aa] H 100.0
/100.0		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7egq[2] M R1AB_SARS2 Helicase[588 aa] H 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease
7egq[1] D R1AB_SARS2 Non-structural protein 8[186 aa] P 100.0
/100.0		 1
/1		 R1AB_SARS2 Proofreading exoribonuclease
5c8s[22] A R1AB_CVHSA Non-structural protein 10[133 aa] B 98.0
/94.9		 49
/49		 R1AB_CVHSA Guanine-N7 methyltransferase
7n0d[2] C R1AB_SARS2 Non-structural protein 10[131 aa] B 100.0
/99.8		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7n0b[1] C RNA (5'-R(*AP*UP*GP*UP*GP*AP*UP*UP*UP*UP*AP*AP*UP*.. B 100.0
/100.0		 7
/7		 R1AB_SARS2 Proofreading exoribonuclease
7n0b[1] D RNA (5'-R(*AP*GP*AP*AP*GP*CP*UP*AP*UP*UP*AP*AP*AP*.. B 100.0
/100.0		 15
/15		 R1AB_SARS2 Proofreading exoribonuclease
7n0c[1] C RNA (25-MER) B 100.0
/99.8		 10
/10		 R1AB_SARS2 Proofreading exoribonuclease
7n0c[1] D RNA (24-MER) B 100.0
/99.8		 18
/18		 R1AB_SARS2 Proofreading exoribonuclease
7n0d[4] E RNA (5'-R(*GP*GP*GP*GP*AP*UP*GP*UP*GP*AP*UP*UP*UP*.. B 100.0
/99.8		 9
/9		 R1AB_SARS2 Proofreading exoribonuclease
7n0d[2] F RNA (5'-R(*CP*UP*AP*UP*UP*AP*AP*AP*AP*UP*CP*AP*CP*.. B 100.0
/99.8		 16
/16		 R1AB_SARS2 Proofreading exoribonuclease
7n0d[2] G RNA (5'-R(*CP*CP*CP*CP*C)-3') B 100.0
/99.8		 1
/1		 R1AB_SARS2 Proofreading exoribonuclease
7n0d[2] G RNA (5'-R(*CP*CP*CP*CP*C)-3') D 100.0
/99.8		 15
/15		 R1AB_SARS2 Proofreading exoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5skw[1] B LF6
{(1R,2R)-2-[(Z)-(3-methyl-1,2,4-thiadiazol-5(2H)-y.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5skx[1] B T6J
2-[(methylsulfonyl)methyl]-1H-benzimidazole[14 ato.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sky[1] G O2M
N-[(4-methyl-1,3-thiazol-2-yl)methyl]-1H-pyrazole-.. 		A 100.0
/100.0		 10
/10		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5skz[1] G NVD
N-{[4-(dimethylamino)phenyl]methyl}-4H-1,2,4-triaz.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl0[1] G B0V
2-methoxy-~{N}-(2,4,6-trimethylphenyl)ethanamide[1.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl0[1] H B0V
2-methoxy-~{N}-(2,4,6-trimethylphenyl)ethanamide[1.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl1[1] G O2A
N-methyl-1H-indole-7-carboxamide[13 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl2[1] G LFO
N,1-dimethyl-1H-indole-3-carboxamide[14 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl3[1] G LGR
2-[acetyl(methyl)amino]benzoic acid[14 atoms] 		A 100.0
/100.0		 10
/10		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl4[1] G LHR
N-(1H-indazol-6-yl)acetamide[13 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl4[1] H LHR
N-(1H-indazol-6-yl)acetamide[13 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl5[1] G WNV
N,N,2,3-tetramethylbenzamide[13 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl6[1] G 60P
3-methylthiophene-2-carboxylic acid[9 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl6[1] H 60P
3-methylthiophene-2-carboxylic acid[9 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl7[1] G W0G
(3R)-1-(2-fluorophenyl)-3-(methylamino)pyrrolidin-.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl8[1] G JGD
N,N-dimethylpyridin-4-amine[9 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl9[1] G O0S
N-{4-[(pyrimidin-2-yl)oxy]phenyl}acetamide[17 atom.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sla[1] G LJR
1-cyclohexyl-N-methylmethanesulfonamide[12 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sla[1] H LJR
1-cyclohexyl-N-methylmethanesulfonamide[12 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slb[1] G LJK
3-methyl-N-(2-methylbutan-2-yl)-1H-pyrazole-5-carb.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slc[1] G U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a.. 		A 100.0
/100.0		 10
/10		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sld[1] G LJ6
(2R)-3-(3,5-dimethyl-1,2-oxazol-4-yl)-N,N,2-trimet.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sle[1] G JGA
N-ethyl-N'-(5-methyl-1,2-oxazol-3-yl)urea[12 atoms.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sle[1] H JGA
N-ethyl-N'-(5-methyl-1,2-oxazol-3-yl)urea[12 atoms.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slf[1] G LJA
N-[3-(carbamoylamino)phenyl]acetamide[14 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slf[1] H LJA
N-[3-(carbamoylamino)phenyl]acetamide[14 atoms] 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slg[1] G NZJ
1-(3-methylbenzene-1-carbonyl)piperidine-4-carboxa.. 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slh[1] G LLU
(2S)-2-(2-fluorophenoxy)propanoic acid[13 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sli[1] G LL0
2-(difluoromethoxy)benzene-1-sulfonamide[14 atoms].. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sli[1] H LL0
2-(difluoromethoxy)benzene-1-sulfonamide[14 atoms].. 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sli[1] I LL0
2-(difluoromethoxy)benzene-1-sulfonamide[14 atoms].. 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slj[1] G LKU
3-fluoro-N-(3-hydroxy-4-methylphenyl)benzamide[18 .. 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slk[1] G LKL
2-[(5-chloro-3-fluoropyridin-2-yl)(methyl)amino]et.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sll[1] G LK6
N-[(3R)-3-methyl-1,1-dioxo-1lambda~6~-thiolan-3-yl.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slm[1] G WN1
N-(2-fluorophenyl)-3-methoxybenzamide[18 atoms] 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sln[1] G LUY
~{N}-(2-phenylethyl)-1~{H}-benzimidazol-2-amine[18.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slo[1] G JJM
1-methyl-N-(3-methylphenyl)-1H-pyrazolo[3,4-d]pyri.. 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slp[1] G UWY
N-(1-ethyl-1H-pyrazol-4-yl)cyclopentanecarboxamide.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slq[1] G ELQ
[3,4-bis(fluoranyl)phenyl]-(4-methylpiperazin-1-yl.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slr[1] G LO6
2-(difluoromethoxy)-1-[(2R,6S)-2,6-dimethylmorphol.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sls[1] G SZE
4-(3-fluoranylpyridin-2-yl)-1-methyl-piperazin-2-o.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slt[1] G LNS
6-(methylcarbamoyl)pyridine-2-carboxylic acid[13 a.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slu[1] G UX1
1-[(2-fluorophenyl)methyl]-N-methylcyclopropane-1-.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slu[1] H UX1
1-[(2-fluorophenyl)methyl]-N-methylcyclopropane-1-.. 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slv[1] G EJQ
~{N}-(4-fluorophenyl)-2-pyrrolidin-1-yl-ethanamide.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slw[1] G U0V
2-fluoro-N-[2-(pyridin-4-yl)ethyl]benzamide[18 ato.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slw[1] H U0V
2-fluoro-N-[2-(pyridin-4-yl)ethyl]benzamide[18 ato.. 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slx[1] G LMW
2-[(4-aminophenyl)(ethyl)amino]ethan-1-ol[13 atoms.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slx[1] H LMW
2-[(4-aminophenyl)(ethyl)amino]ethan-1-ol[13 atoms.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sly[1] G LM6
1-(1-ethyl-1H-pyrazol-5-yl)-N-methylmethanamine[10.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5slz[1] G LQP
2-(difluoromethoxy)-1-[(3aR,6aS)-hexahydrocyclopen.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm0[1] G LQI
(1-benzofuran-2-yl)(4-methylpiperidin-1-yl)methano.. 		A 100.0
/100.0		 10
/10		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm1[1] G WH1
N-methyl-N-[2-(pyridin-2-yl)ethyl]benzamide[18 ato.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm2[1] G LQ3
(5S)-5-(difluoromethoxy)pyridin-2(5H)-one[11 atoms.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm2[1] H LQ3
(5S)-5-(difluoromethoxy)pyridin-2(5H)-one[11 atoms.. 		A 100.0
/100.0		 10
/10		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm3[1] G GT4
~{N}-(4-hydroxyphenyl)-2-methoxy-ethanamide[13 ato.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm4[1] G AWD
~{N}-(4-fluorophenyl)-4-methyl-piperazine-1-carbox.. 		A 100.0
/100.0		 10
/10		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm5[1] G S5J
2-[4-(2-methoxyphenyl)piperazin-1-yl]ethanenitrile.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm6[1] G K1A
3-[(3,5-dimethyl-1,2-oxazol-4-yl)methyl]-5-methyl-.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm7[1] G LPU
1-(methanesulfonyl)piperidin-4-ol[11 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm8[1] G WKA
N-(2,1,3-benzoxadiazol-4-yl)acetamide[13 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm9[1] G VZS
N-(2-methoxy-5-methylphenyl)-N'-4H-1,2,4-triazol-4.. 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sma[1] G NZD
4-methyl-N-phenylpiperazine-1-carboxamide[16 atoms.. 		A 100.0
/100.0		 10
/10		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5smb[1] G LRR
1-(morpholin-4-yl)-4-phenylbutan-1-one[17 atoms] 		A 100.0
/100.0		 10
/10		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5smc[1] G LRF
N~2~-(4-cyano-3-methyl-1,2-thiazol-5-yl)-N~2~-meth.. 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5smc[1] H LRF
N~2~-(4-cyano-3-methyl-1,2-thiazol-5-yl)-N~2~-meth.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5smd[1] G WKS
2,4-dimethyl-6-(piperazin-1-yl)pyrimidine[14 atoms.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5sme[1] G I8D
(4-chlorophenyl)(thiomorpholin-4-yl)methanone[15 a.. 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5smf[1] G K1S
N,N-diethyl-5-methyl[1,2,4]triazolo[1,5-a]pyrimidi.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5smf[1] H K1S
N,N-diethyl-5-methyl[1,2,4]triazolo[1,5-a]pyrimidi.. 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5smg[1] G LR9
3-amino-N-ethyl-N-methylbenzamide[13 atoms] 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5smh[1] G 7ZC
1-(5-methoxy-1H-indol-3-yl)-N,N-dimethyl-methanami.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5smi[1] G LQV
(2S)-N-(5-methylpyridin-2-yl)oxolane-2-carboxamide.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7qif[1] B GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52.. 		A 100.0
/100.0		 14
/14		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7n0d[4] LA 1N7
CHAPSO[25 atoms] 		B 100.0
/99.8		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease
5c8s[4] K SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] 		B 100.0
/94.9		 14
/14		 R1AB_CVHSA Guanine-N7 methyltransferase
7tw8[1] B SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] 		A 100.0
/98.9		 13
/13		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
8frj[1] C AW2
5-bromo-7-{5-[(3-{[(4-tert-butylphenyl)carbamoyl]a.. 		A 100.0
/98.9		 16
/16		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..
5c8t[2] K SAM
S-ADENOSYLMETHIONINE[27 atoms] 		B 100.0
/94.9		 13
/13		 R1AB_CVHSA Guanine-N7 methyltransferase
7tw7[1] C SAM
S-ADENOSYLMETHIONINE[27 atoms] 		A 100.0
/98.9		 13
/13		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
7tw9[1] B SFG
SINEFUNGIN[27 atoms] 		A 100.0
/98.9		 13
/13		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
8frk[1] D MJ7
5'-S-(4-{[(4'-chloro[1,1'-biphenyl]-3-yl)methyl]am.. 		A 100.0
/98.9		 14
/14		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..
5c8s[2] L G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms.. 		B 100.0
/94.9		 16
/16		 R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7n0b[2] G CA
CALCIUM ION[1 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
5c8s[17] J MG
MAGNESIUM ION[1 atoms] 		B 100.0
/94.9		 3
/3		 R1AB_CVHSA Guanine-N7 methyltransferase
7diy[1] G MG
MAGNESIUM ION[1 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 nsp14-ExoN protein
7egq[2] HA MG
MAGNESIUM ION[1 atoms] 		H 100.0
/100.0		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] V CL
CHLORIDE ION[1 atoms] 		A 100.0
/99.7		 1
/1		 R1AB_SARS2 Proofreading exoribonuclease
5c8s[13] G ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[13] H ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[13] I ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[5] G ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[4] H ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[4] I ZN
ZINC ION[1 atoms] 		B 100.0
/94.9		 4
/4		 R1AB_CVHSA Guanine-N7 methyltransferase
5nfy[4] I ZN
ZINC ION[1 atoms] 		A 100.0
/94.7		 5
/5		 Q1T6X8_CVHSA Polyprotein 1ab
5nfy[4] J ZN
ZINC ION[1 atoms] 		A 100.0
/94.7		 4
/4		 Q1T6X8_CVHSA Polyprotein 1ab
5nfy[4] K ZN
ZINC ION[1 atoms] 		A 100.0
/94.7		 5
/5		 Q1T6X8_CVHSA Polyprotein 1ab
5skw[62] E ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5skw[62] F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5skw[62] G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7diy[2] E ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 nsp14-ExoN protein
7diy[7] F ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 4
/4		 R1AB_SARS2 nsp14-ExoN protein
7mc5[1] D ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7r2v[1] I ZN
ZINC ION[1 atoms] 		A 100.0
/99.5		 2
/2		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7r2v[2] J ZN
ZINC ION[1 atoms] 		A 100.0
/99.5		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
8frk[1] E K
POTASSIUM ION[1 atoms] 		A 100.0
/98.9		 4
/4		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Guanine-N7 methyltransfe..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7n0d[2] D R1AB_SARS2 Proofreading exoribonuclease[512 aa] B 100.0
/99.8		 9
/9		 R1AB_SARS2 Proofreading exoribonuclease
7n0d[4] K R1AB_SARS2 Proofreading exoribonuclease[512 aa] B 100.0
/99.8		 14
/14		 R1AB_SARS2 Proofreading exoribonuclease
7n0d[2] B R1AB_SARS2 Proofreading exoribonuclease[512 aa] D 100.0
/99.8		 11
/11		 R1AB_SARS2 Proofreading exoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5skw[62] C PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5skw[62] D PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7mc5[1] P TLA
L(+)-TARTARIC ACID[10 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] Q TLA
L(+)-TARTARIC ACID[10 atoms] 		A 100.0
/99.7		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] AA EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 1
/1		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] DA EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 2
/2		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[4] E EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 2
/2		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] F EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 6
/6		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] H EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] I EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] J EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] K EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] L EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] M EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[2] N EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] O EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] R EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[2] T EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] U EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc5[1] W EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.7		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
7mc6[1] E EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.6		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease
7mc6[1] F EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.6		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
7mc6[1] G EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.6		 5
/5		 R1AB_SARS2 Proofreading exoribonuclease
7mc6[1] K EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.6		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease
7mc6[1] P EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/99.6		 1
/1		 R1AB_SARS2 Proofreading exoribonuclease
7r2v[1] E TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] 		A 100.0
/99.5		 2
/2		 R1AB_SARS2 Proofreading exoribonuclease nsp14
5nfy[2] L PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/94.7		 2
/2		 Q1T6X8_CVHSA Polyprotein 1ab
7r2v[2] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/99.5		 4
/4		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7r2v[1] K PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/99.5		 3
/3		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7r2v[1] N PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/99.5		 1
/1		 R1AB_SARS2 Proofreading exoribonuclease nsp14
7tw9[1] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/98.9		 6
/6		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
7tw9[1] E EOH
ETHANOL[3 atoms] 		A 100.0
/98.9		 4
/4		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
7tw9[2] F MOH
METHANOL[2 atoms] 		A 100.0
/98.9		 3
/3		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
7tw9[1] I MOH
METHANOL[2 atoms] 		A 100.0
/98.9		 4
/4		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
7tw9[1] J MOH
METHANOL[2 atoms] 		A 100.0
/98.9		 4
/4		 ETV6_HUMAN R1AB_SARS2 Transcription factor ETV6,Proofreading exoribonucl..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.