#WARNING:no index is registered index "YP_009725307.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725307.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1699738 932 60 YP_009725307.1()
QUERYSEQ
SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYN
CCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVN
CLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAI
SDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHN
MLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLR
KHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHML
DMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725307.1()]

932
region name description
1-932 DISORDER predicted by DISOPRED

MONOMER
932
pdb_id a1 identity[%]2 description
8gwe A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6m71[55] B R1AB_SARS2 Non-structural protein 7[70 aa] A 100.0
/100.0
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7bw4[1] C R1AB_SARS2 Non-structural protein 7[65 aa] A 100.0
/100.0
10
/10
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] C R1AB_SARS2 Non-structural protein 7[72 aa] A 100.0
/100.0
18
/18
R1AB_SARS2 RNA-directed RNA polymerase
6m71[1] C R1AB_SARS2 Non-structural protein 8[43 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
6m71[54] D R1AB_SARS2 Non-structural protein 8[113 aa] A 100.0
/100.0
46
/46
R1AB_SARS2 RNA-directed RNA polymerase
6nur[1] D R1A_CVHSA NSP8[109 aa] A 100.0
/97.0
2
/2
R1AB_CVHSA NSP12
6xez[34] D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7btf[6] D R1AB_SARS2 Non-structural protein 8[104 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7bw4[1] B R1AB_SARS2 Non-structural protein 8[115 aa] A 100.0
/100.0
42
/42
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] B R1AB_SARS2 Non-structural protein 8[150 aa] A 100.0
/100.0
52
/52
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] D R1AB_SARS2 Non-structural protein 8[154 aa] A 100.0
/100.0
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7l1f[1] B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/100.0
40
/40
R1AB_SARS2 RNA-directed RNA polymerase
7re3[2] G R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6xez[24] E R1AB_SARS2 Helicase[596 aa] A 100.0
/100.0
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
7cxn[1] H R1AB_SARS2 Helicase[596 aa] A 100.0
/99.9
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7re3[2] N R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0
10
/10
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[1] D R1AB_SARS2 Non-structural protein 8[31 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7aap[2] D R1AB_SARS2 Non-structural protein 8[28 aa] A 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 12
7bv1[1] D R1AB_SARS2 Non-structural protein 8[99 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[11] I R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0
19
/19
R1AB_SARS2 RNA-directed RNA polymerase
7egq[3] H R1AB_SARS2 Proofreading exoribonuclease[523 aa] A 100.0
/100.0
2
/2
R1AB_SARS2 RNA-directed RNA polymerase
7egq[2] P R1AB_SARS2 Proofreading exoribonuclease[524 aa] A 100.0
/100.0
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7oyg[2] B R1AB_SARS2 SARS-CoV-2 nsp8[81 aa] A 100.0
/100.0
28
/28
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7thm[1] C R1AB_SARS2 Non-structural protein 7[37 aa] A 100.0
/100.0
7
/7
R1AB_SARS2 RNA-directed RNA polymerase
7thm[1] E R1AB_SARS2 Non-structural protein 9[74 aa] A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
8g6r[1] B A0A1Z2R8Q6_9ALPC nsp8[114 aa] A 53.5
/60.9
43
/44
A0A0U2C263_9ALPC nsp12
8g6r[1] C A0A0M4AW09_9ALPC nsp7[62 aa] A 81.2
/60.9
16
/16
A0A0U2C263_9ALPC nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[9] G Product RNA A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] H Template RNA A 100.0
/100.0
21
/21
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[1] E RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[1] F RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0
19
/19
R1AB_SARS2 RNA-directed RNA polymerase
6yyt[1] E RNA product A 100.0
/100.0
14
/14
R1AB_SARS2 nsp12
6yyt[1] G RNA product A 100.0
/100.0
26
/26
R1AB_SARS2 nsp12
7aap[1] E RNA (5'-R(P*UP*UP*AP*AP*GP*UP*UP*AP*U)-3') A 100.0
/100.0
16
/16
R1AB_SARS2 Non-structural protein 12
7aap[1] F RNA (5'-R(P*UP*UP*CP*AP*UP*AP*AP*CP*UP*UP*AP*A)-3'.. A 100.0
/100.0
23
/23
R1AB_SARS2 Non-structural protein 12
7b3b[1] D DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*G)-D(P*(RMP))-R(.. A 100.0
/100.0
14
/14
R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3b[1] E RNA (5'-R(P*UP*GP*CP*AP*UP*CP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/100.0
28
/28
R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3c[1] D DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*A)-D(P*(RMP))-R(.. A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3c[1] E RNA (5'-R(P*UP*CP*AP*CP*UP*UP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/100.0
26
/26
R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3d[3] D RNA (5'-R(P*CP*UP*AP*CP*GP*CP*AP*GP*UP*G)-3') A 100.0
/100.0
14
/14
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7b3d[3] E RNA (5'-R(P*UP*GP*CP*AP*CP*UP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/100.0
29
/29
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7bv2[1] D Primer A 100.0
/100.0
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
7bv2[1] E Templete A 100.0
/100.0
26
/26
R1AB_SARS2 RNA-directed RNA polymerase
7bzf[1] E RNA (31-MER) A 100.0
/100.0
25
/25
R1AB_SARS2 RNA-directed RNA polymerase
7bzf[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
7c2k[1] E RNA (29-MER) A 100.0
/100.0
24
/24
R1AB_SARS2 RNA-directed RNA polymerase
7c2k[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7ctt[1] E Primer-RNA (5'-R(P*UP*UP*CP*UP*CP*CP*UP*AP*AP*GP*A.. A 100.0
/100.0
18
/18
R1AB_SARS2 RNA-directed RNA polymerase
7ctt[1] F Template-RNA (5'-R(P*AP*CP*UP*AP*GP*CP*UP*UP*CP*UP.. A 100.0
/100.0
25
/25
R1AB_SARS2 RNA-directed RNA polymerase
7cxm[12] E RNA (25-MER) A 100.0
/99.9
10
/10
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[1] E Primer A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[1] F Template A 100.0
/100.0
30
/30
R1AB_SARS2 RNA-directed RNA polymerase
7dfg[2] A RNA (5'-R(P*AP*GP*AP*UP*UP*AP*AP*GP*UP*UP*AP*U)-3'.. C 100.0
/100.0
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
7dfg[1] B RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. C 100.0
/100.0
30
/30
R1AB_SARS2 RNA-directed RNA polymerase
7dfh[1] E RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*G*(LIG))-3') A 100.0
/100.0
13
/13
R1AB_SARS2 RNA-directed RNA polymeras
7dfh[1] F RNA (5'-R(P*CP*CP*CP*CP*CP*AP*CP*AP*UP*AP*GP*C)-3'.. A 100.0
/100.0
24
/24
R1AB_SARS2 RNA-directed RNA polymeras
7doi[1] E RNA (5'-R(P*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP*UP.. A 100.0
/100.0
28
/28
R1AB_SARS2 RNA-directed RNA polymerase
7dok[1] A RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. C 100.0
/100.0
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] E RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. A 100.0
/100.0
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7dok[1] B RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. C 100.0
/100.0
26
/26
R1AB_SARS2 RNA-directed RNA polymerase
7dte[1] E RNA (57-MER) A 100.0
/100.0
27
/27
R1AB_SARS2 RNA-directed RNA polymerase
7dte[1] F RNA (33-MER) A 100.0
/100.0
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] F RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. A 100.0
/100.0
28
/28
R1AB_SARS2 RNA-directed RNA polymerase
7egq[2] T Template RNA A 100.0
/100.0
27
/27
R1AB_SARS2 RNA-directed RNA polymerase
7eiz[1] H template A 100.0
/100.0
21
/21
R1AB_SARS2 RNA-directed RNA polymerase
7krn[3] F RNA (37-MER) A 100.0
/100.0
20
/20
R1AB_SARS2 RNA-directed RNA polymerase
7krn[2] G RNA (43-MER) A 100.0
/100.0
27
/27
R1AB_SARS2 RNA-directed RNA polymerase
7krp[1] F RNA (36-MER) A 100.0
/100.0
28
/28
R1AB_SARS2 RNA-directed RNA polymerase
7l1f[1] D RNA (5'-R(P*CP*UP*AP*AP*GP*AP*AP*GP*CP*UP*AP*UP*U*.. A 100.0
/100.0
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7l1f[1] E RNA (5'-R(P*AP*UP*UP*UP*UP*AP*AP*UP*AP*GP*CP*UP*UP.. A 100.0
/100.0
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
7ozu[1] D Product RNA A 100.0
/100.0
14
/14
R1AB_SARS2 Replicase polyprotein 1ab
7ozu[2] E Template RNA A 100.0
/100.0
30
/30
R1AB_SARS2 Replicase polyprotein 1ab
7ozv[1] D Product RNA A 100.0
/100.0
12
/12
R1AB_SARS2 Replicase polyprotein 1ab
7rdx[1] H Template RNA A 100.0
/100.0
34
/34
R1AB_SARS2 RNA-directed RNA polymerase
7rdy[1] H Template RNA A 100.0
/100.0
32
/32
R1AB_SARS2 RNA-directed RNA polymerase
7rdz[6] H Template RNA A 100.0
/100.0
31
/31
R1AB_SARS2 RNA-directed RNA polymerase
7uo4[1] E Product RNA (35-MER) A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
7uo4[1] F Template RNA (55-MER) A 100.0
/100.0
28
/28
R1AB_SARS2 RNA-directed RNA polymerase
7uo7[1] D Product RNA (35-MER) A 100.0
/100.0
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7uo7[1] E Template RNA (55-MER) A 100.0
/100.0
27
/27
R1AB_SARS2 RNA-directed RNA polymerase
7uo9[1] D Product RNA (35-MER) A 100.0
/100.0
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
7uo9[1] E Template RNA (55-MER) A 100.0
/100.0
34
/34
R1AB_SARS2 RNA-directed RNA polymerase
7uob[2] E Product RNA (35-MER) A 100.0
/100.0
10
/10
R1AB_SARS2 RNA-directed RNA polymerase
7uob[1] F Template RNA (55-MER) A 100.0
/100.0
24
/24
R1AB_SARS2 RNA-directed RNA polymerase
7uoe[1] F Template RNA (55-MER) A 100.0
/100.0
30
/30
R1AB_SARS2 RNA-directed RNA polymerase
8gwb[7] F template A 100.0
/100.0
26
/26
R1AB_SARS2 RNA-directed RNA polymerase
8gwb[1] J RNA (5'-R(P*AP*U)-3') A 100.0
/100.0
10
/10
R1AB_SARS2 RNA-directed RNA polymerase
8gwe[1] J RNA (5'-R(P*AP*UP*UP*A)-3') A 100.0
/100.0
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
7cxm[2] F RNA (26-MER) A 100.0
/99.9
23
/23
R1AB_SARS2 RNA-directed RNA polymerase
8g6r[1] D RNA (5'-R(P*AP*AP*GP*AP*AP*GP*CP*UP*AP*UP*UP*AP*AP.. A 93.8
/60.9
16
/16
A0A0U2C263_9ALPC nsp12
8g6r[1] E RNA (5'-R(P*GP*GP*UP*UP*GP*UP*GP*AP*UP*UP*UP*UP*AP.. A 77.8
/60.9
27
/27
A0A0U2C263_9ALPC nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[12] L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/100.0
11
/11
R1AB_SARS2 RNA-directed RNA polymerase
6xez[8] M 1N7
CHAPSO[35 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
6xez[8] N 1N7
CHAPSO[26 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6xez[10] U 1N7
CHAPSO[36 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7aap[2] M GE6
[[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-5-f..
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 12
7bv2[1] K F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-..
A 100.0
/100.0
7
/7
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[1] L GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 RNA-directed RNA polymerase
7d4f[1] G H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal..
D 100.0
/100.0
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7d4f[1] H H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal..
D 100.0
/100.0
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7dfg[1] G 1RP
6-fluoro-3-oxo-4-(5-O-phosphono-beta-D-ribofuranos..
C 100.0
/100.0
7
/7
R1AB_SARS2 RNA-directed RNA polymerase
7dfh[1] N RVP
RIBAVIRIN MONOPHOSPHATE[20 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 RNA-directed RNA polymeras
7doi[2] O HCU
[(2R)-4-(2-azanyl-6-oxidanylidene-3H-purin-9-yl)-2..
A 100.0
/100.0
6
/6
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] J AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur..
A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] K AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur..
A 100.0
/100.0
11
/11
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] N AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur..
A 100.0
/100.0
6
/6
R1AB_SARS2 RNA-directed RNA polymerase
7uo4[1] G NWX
[[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1..
A 100.0
/100.0
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7uo7[1] G ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
A 100.0
/100.0
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
7uo9[1] J UTP
URIDINE 5'-TRIPHOSPHATE [29 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7uob[1] L GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
7uob[4] M GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 100.0
/100.0
19
/19
R1AB_SARS2 RNA-directed RNA polymerase
7uob[2] N L2B
3'-DEOXYURIDINE-5'-MONOPHOSPHATE[19 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
7uoe[1] K CTP
CYTIDINE-5'-TRIPHOSPHATE[29 atoms]
A 100.0
/100.0
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
8gwe[3] M GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato..
A 100.0
/100.0
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6nur[4] E ZN
ZINC ION[1 atoms]
A 100.0
/97.0
4
/4
R1AB_CVHSA NSP12
6nur[4] F ZN
ZINC ION[1 atoms]
A 100.0
/97.0
4
/4
R1AB_CVHSA NSP12
6xez[37] I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6xez[37] J ZN
ZINC ION[1 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[8] G ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[8] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6yyt[6] I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
6yyt[6] J ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
7bw4[1] E ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7bw4[1] F ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] G ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
8g6r[1] F ZN
ZINC ION[1 atoms]
A 100.0
/60.9
4
/4
A0A0U2C263_9ALPC nsp12
8g6r[1] G ZN
ZINC ION[1 atoms]
A 100.0
/60.9
4
/4
A0A0U2C263_9ALPC nsp12
6xez[22] K MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[20] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[2] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] L MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
8gwe[1] T MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 RNA-directed RNA polymerase
7thm[3] H MN
MANGANESE (II) ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7egq[2] I R1AB_SARS2 RNA-directed RNA polymerase[926 aa] A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7re3[2] J R1AB_SARS2 RNA-directed RNA polymerase[927 aa] A 100.0
/100.0
9
/9
R1AB_SARS2 RNA-directed RNA polymerase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7aap[2] K POP
PYROPHOSPHATE 2-[9 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 12
7bv2[5] H POP
PYROPHOSPHATE 2-[9 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
7dfg[4] M POP
PYROPHOSPHATE 2-[9 atoms]
C 100.0
/100.0
7
/7
R1AB_SARS2 RNA-directed RNA polymerase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.