#WARNING:no index is registered index 'YP_009725307.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
19566 932 18 YP_009725307.1()
QUERYSEQ 
SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYN
CCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVN
CLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAI
SDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHN
MLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLR
KHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHML
DMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725307.1()]

932
region name description
1-932 DISORDER predicted by DISOPRED (1-16,929-932)

MONOMER
932
pdb_id a1 identity[%]2 description
7c2k A 100.0 R1AB_SARS2 RNA-directed RNA polymerase 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7bv1[1] D R1AB_SARS2 nsp8[99 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 nsp12
6m71[1] C R1AB_SARS2 SARS-Cov-2 NSP 8[43 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 SARS-Cov-2 NSP 12
7bv2[16] C R1AB_SARS2 nsp7[63 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 nsp12
7bw4[1] C R1AB_SARS2 Replicase polyprotein 1ab[65 aa] A 100.0
/100.0		 10
/10		 R1AB_SARS2 Replicase polyprotein 1ab
7aap[2] F R1AB_SARS2 Non-structural protein 8[28 aa] A 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 12
6xqb[1] D R1AB_SARS2 Non-structural protein 8[31 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq[1] I R1AB_SARS2 Replicase polyprotein 1ab[113 aa] A 100.0
/100.0		 19
/19		 R1AB_SARS2 Replicase polyprotein 1ab
6xez[6] D R1AB_SARS2 nsp8[186 aa] A 100.0
/100.0		 12
/12		 R1AB_SARS2 nsp12
7d4f[17] A R1AB_SARS2 Non-structural protein 8[114 aa] D 100.0
/100.0		 48
/48		 R1AB_SARS2 Non-structural protein 12
7bzf[3] D R1AB_SARS2 Non-structural protein 8[104 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7bw4[1] B R1AB_SARS2 Replicase polyprotein 1ab[115 aa] A 100.0
/100.0		 42
/42		 R1AB_SARS2 Replicase polyprotein 1ab
6nur[1] D R1A_CVHSA NSP8[109 aa] A 100.0
/97.0		 2
/2		 R1AB_CVHSA NSP12
7cxn[1] H R1AB_SARS2 nsp13[596 aa] A 100.0
/99.9		 1
/1		 R1AB_SARS2 nsp12
6xez[4] E R1AB_SARS2 nsp13[596 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7bzf[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7aap[1] D RNA (5'-R(P*UP*UP*AP*AP*GP*UP*UP*AP*U)-3') A 100.0
/100.0		 16
/16		 R1AB_SARS2 Non-structural protein 12
7bv2[1] E Templete A 100.0
/100.0		 26
/26		 R1AB_SARS2 nsp12
7cyq[1] E Primer A 100.0
/100.0		 16
/16		 R1AB_SARS2 Replicase polyprotein 1ab
7cyq[1] F Template A 100.0
/100.0		 30
/30		 R1AB_SARS2 Replicase polyprotein 1ab
6yyt[1] G RNA product A 100.0
/100.0		 26
/26		 R1AB_SARS2 nsp12
7bzf[1] E RNA (31-MER) A 100.0
/100.0		 25
/25		 R1AB_SARS2 RNA-directed RNA polymerase
7c2k[1] E RNA (29-MER) A 100.0
/100.0		 24
/24		 R1AB_SARS2 RNA-directed RNA polymerase
7ctt[1] F Template-RNA (5'-R(P*AP*CP*UP*AP*GP*CP*UP*UP*CP*UP.. A 100.0
/100.0		 25
/25		 R1AB_SARS2 nsp12
7bv2[1] D Primer A 100.0
/100.0		 15
/15		 R1AB_SARS2 nsp12
6yyt[1] E RNA product A 100.0
/100.0		 14
/14		 R1AB_SARS2 nsp12
7aap[1] E RNA (5'-R(P*UP*UP*CP*AP*UP*AP*AP*CP*UP*UP*AP*A)-3'.. A 100.0
/100.0		 23
/23		 R1AB_SARS2 Non-structural protein 12
6xqb[1] E RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] H Template RNA A 100.0
/100.0		 21
/21		 R1AB_SARS2 nsp12
7c2k[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7ctt[1] E Primer-RNA (5'-R(P*UP*UP*CP*UP*CP*CP*UP*AP*AP*GP*A.. A 100.0
/100.0		 18
/18		 R1AB_SARS2 nsp12
6xez[1] G Product RNA A 100.0
/100.0		 16
/16		 R1AB_SARS2 nsp12
6xqb[1] F RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0		 19
/19		 R1AB_SARS2 RNA-directed RNA polymerase
7cxm[2] F RNA (26-MER) A 100.0
/99.9		 23
/23		 R1AB_SARS2 nsp12
7cxn[2] E Primer RNA A 100.0
/99.9		 9
/9		 R1AB_SARS2 nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7cyq[1] L GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 Replicase polyprotein 1ab
6xez[1] U 1N7
CHAPSO[36 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 nsp12
6xez[1] M 1N7
CHAPSO[35 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 nsp12
6xez[1] N 1N7
CHAPSO[26 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 nsp12
7aap[2] M GE6
[[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-5-f.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 12
6xez[1] L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 nsp12
7bv2[1] K F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 nsp12
7d4f[1] G H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal.. 		D 100.0
/100.0		 12
/12		 R1AB_SARS2 Non-structural protein 12
7d4f[1] H H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal.. 		D 100.0
/100.0		 12
/12		 R1AB_SARS2 Non-structural protein 12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7bv2[2] I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 nsp12
7aap[3] J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 12
7bv2[3] J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 nsp12
7c2k[3] G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7bv1[4] E ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 nsp12
6nus[3] D ZN
ZINC ION[1 atoms] 		A 100.0
/96.6		 4
/4		 R1AB_CVHSA NSP12
7cxn[8] J ZN
ZINC ION[1 atoms] 		A 100.0
/99.9		 4
/4		 R1AB_SARS2 nsp12
6yyt[1] I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 nsp12
7bv1[4] F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 nsp12
7cxn[8] K ZN
ZINC ION[1 atoms] 		A 100.0
/99.9		 6
/6		 R1AB_SARS2 nsp12
6yyt[1] J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 nsp12
7bw4[1] F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Replicase polyprotein 1ab
7bw4[1] E ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7aap[1] K POP
PYROPHOSPHATE 2-[9 atoms] 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 12
7bv2[1] H POP
PYROPHOSPHATE 2-[9 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.