HOMCOS(prot_sch_conbars.cgi):

#WARNING:no index is registered index "YP_009725304.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725304.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
1699338	198	133	YP_009725304.1()
QUERYSEQ	AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYA SALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725304.1()]

198
	region	name	description
	1-198	DISORDER	predicted by DISOPRED

MONOMER

198

pdb_id a¹ identity[%]² description

7uo9 B 100.0 R1AB_SARS2 Non-structural protein 8

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

198 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2ahm[67] A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] E 100.0
/97.4 24
/24 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm[4] A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] E 100.0
/97.4 5
/5 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm[4] A R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa] G 100.0
/97.4 3
/3 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm[4] D R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa] G 100.0
/97.4 8
/8 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

5f22[15] A R1A_CVHSA Non-structural protein 7[79 aa] B 100.0
/96.5 25
/25 R1AB_CVHSA Non-structural protein

6m71[54] B R1AB_SARS2 Non-structural protein 7[70 aa] D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

6wiq[8] A R1AB_SARS2 Non-structural protein 7[80 aa] B 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 8

7ed5[1] C R1AB_SARS2 Non-structural protein 7[72 aa] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7jlt[2] C R1AB_SARS2 Non-structural protein 7[81 aa] B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 8

7l1f[1] C R1AB_SARS2 Non-structural protein 7[63 aa] B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

6m71[46] A R1AB_SARS2 RNA-directed RNA polymerase[859 aa] C 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

6m71[58] A R1AB_SARS2 RNA-directed RNA polymerase[859 aa] D 100.0
/100.0 42
/42 R1AB_SARS2 Non-structural protein 8

7l1f[1] A R1AB_SARS2 RNA-directed RNA polymerase[832 aa] B 100.0
/100.0 36
/36 R1AB_SARS2 Non-structural protein 8

7re3[2] J R1AB_SARS2 RNA-directed RNA polymerase[927 aa] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

6xez[54] F R1AB_SARS2 Helicase[596 aa] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7egq[1] E R1AB_SARS2 Helicase[588 aa] D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7rdz[1] E R1AB_SARS2 Helicase[590 aa] D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7re0[1] E R1AB_SARS2 Helicase[590 aa] B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7egq[1] P R1AB_SARS2 Proofreading exoribonuclease[524 aa] D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7thm[1] C R1AB_SARS2 Non-structural protein 7[37 aa] D 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 8

6nus[1] A R1AB_CVHSA NSP12[715 aa] B 100.0
/96.4 40
/40 R1A_CVHSA NSP8

3ub0[2] B R1AB_FIPV Non-structural protein 7, nsp7[82 aa] A 33.3
/42.7 12
/12 R1AB_FIPV Non-structural protein 6, nsp6,

3ub0[2] C R1AB_FIPV Non-structural protein 7, nsp7[82 aa] A 61.3
/42.7 31
/31 R1AB_FIPV Non-structural protein 6, nsp6,

8g6r[1] A A0A0U2C263_9ALPC nsp12[899 aa] B 50.0
/38.4 42
/42 A0A1Z2R8Q6_9ALPC nsp8

8g6r[1] C A0A0M4AW09_9ALPC nsp7[62 aa] B 50.0
/38.4 2
/2 A0A1Z2R8Q6_9ALPC nsp8

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

198 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6xez[18] G Product RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

6xez[2] H Template RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

6yyt[4] F RNA product B 100.0
/100.0 4
/4 R1AB_SARS2 nsp8

6yyt[1] G RNA product D 100.0
/100.0 3
/3 R1AB_SARS2 nsp8

7c2k[1] E RNA (29-MER) D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7cxm[24] E RNA (25-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7cxm[4] F RNA (26-MER) B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7cyq[2] E Primer B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7cyq[1] F Template B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7cyq[1] F Template D 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7dok[2] A RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. D 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7ed5[1] E RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7ed5[1] E RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. D 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7dok[1] B RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. F 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7dte[2] E RNA (57-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7dte[2] F RNA (33-MER) B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7ed5[1] F RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7ed5[1] F RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. D 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 8

7egq[3] T Template RNA B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7eiz[2] H template B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

7krn[6] F RNA (37-MER) B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7krn[4] G RNA (43-MER) B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7krp[2] F RNA (36-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7rdx[2] H Template RNA B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 8

7rdy[2] H Template RNA B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7rdz[12] H Template RNA B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

7uo4[2] E Product RNA (35-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uo4[2] F Template RNA (55-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7uo7[2] D Product RNA (35-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uo7[2] E Template RNA (55-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uo9[2] D Product RNA (35-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7uo9[2] E Template RNA (55-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7uob[4] E Product RNA (35-MER) B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

7uob[2] F Template RNA (55-MER) B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

7uoe[2] F Template RNA (55-MER) B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

8gwb[14] F template B 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 8

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

198 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7krn[9] T 1N7
CHAPSO[36 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 8

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

198 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2ahm[12] E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] E 100.0
/97.4 19
/19 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm[4] G R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] E 100.0
/97.4 8
/8 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm[6] H R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa] E 100.0
/97.4 5
/5 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm[4] E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] G 100.0
/97.4 7
/7 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm[2] E R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa] H 100.0
/97.4 7
/7 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

198 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6wqd[2] F EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

6wqd[3] G EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

6xip[1] F EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 8

6wtc[1] E ACY
ACETIC ACID[4 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 8

6wtc[1] F ACY
ACETIC ACID[4 atoms] D 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 8

2ahm[2] N SO4
SULFATE ION[5 atoms] H 75.0
/97.4 4
/4 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm[6] I GOL
GLYCEROL[6 atoms] E 100.0
/97.4 2
/2 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm[6] I GOL
GLYCEROL[6 atoms] E 100.0
/97.4 1
/1 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

2ahm[4] J GOL
GLYCEROL[6 atoms] E 100.0
/97.4 3
/3 R1AB_CVHSA Replicase polyprotein 1ab, heavy chain

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
198
	pdb_id	a¹	identity[%]²	description
	7uo9	B	100.0	R1AB_SARS2 Non-structural protein 8
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
198	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	2ahm[67]	A	R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa]	E	100.0 /97.4	24 /24	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	2ahm[4]	A	R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa]	E	100.0 /97.4	5 /5	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	2ahm[4]	A	R1AB_CVHSA Replicase polyprotein 1ab, light chain[77 aa]	G	100.0 /97.4	3 /3	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	2ahm[4]	D	R1AB_CVHSA Replicase polyprotein 1ab, light chain[76 aa]	G	100.0 /97.4	8 /8	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	5f22[15]	A	R1A_CVHSA Non-structural protein 7[79 aa]	B	100.0 /96.5	25 /25	R1AB_CVHSA Non-structural protein
	6m71[54]	B	R1AB_SARS2 Non-structural protein 7[70 aa]	D	100.0 /100.0	3 /3	R1AB_SARS2 Non-structural protein 8
	6wiq[8]	A	R1AB_SARS2 Non-structural protein 7[80 aa]	B	100.0 /100.0	8 /8	R1AB_SARS2 Non-structural protein 8
	7ed5[1]	C	R1AB_SARS2 Non-structural protein 7[72 aa]	B	100.0 /100.0	5 /5	R1AB_SARS2 Non-structural protein 8
	7jlt[2]	C	R1AB_SARS2 Non-structural protein 7[81 aa]	B	100.0 /100.0	7 /7	R1AB_SARS2 Non-structural protein 8
	7l1f[1]	C	R1AB_SARS2 Non-structural protein 7[63 aa]	B	100.0 /100.0	1 /1	R1AB_SARS2 Non-structural protein 8
	6m71[46]	A	R1AB_SARS2 RNA-directed RNA polymerase[859 aa]	C	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	6m71[58]	A	R1AB_SARS2 RNA-directed RNA polymerase[859 aa]	D	100.0 /100.0	42 /42	R1AB_SARS2 Non-structural protein 8
	7l1f[1]	A	R1AB_SARS2 RNA-directed RNA polymerase[832 aa]	B	100.0 /100.0	36 /36	R1AB_SARS2 Non-structural protein 8
	7re3[2]	J	R1AB_SARS2 RNA-directed RNA polymerase[927 aa]	B	100.0 /100.0	3 /3	R1AB_SARS2 Non-structural protein 8
	6xez[54]	F	R1AB_SARS2 Helicase[596 aa]	B	100.0 /100.0	6 /6	R1AB_SARS2 Non-structural protein 8
	7egq[1]	E	R1AB_SARS2 Helicase[588 aa]	D	100.0 /100.0	1 /1	R1AB_SARS2 Non-structural protein 8
	7rdz[1]	E	R1AB_SARS2 Helicase[590 aa]	D	100.0 /100.0	1 /1	R1AB_SARS2 Non-structural protein 8
	7re0[1]	E	R1AB_SARS2 Helicase[590 aa]	B	100.0 /100.0	1 /1	R1AB_SARS2 Non-structural protein 8
	7egq[1]	P	R1AB_SARS2 Proofreading exoribonuclease[524 aa]	D	100.0 /100.0	1 /1	R1AB_SARS2 Non-structural protein 8
	7thm[1]	C	R1AB_SARS2 Non-structural protein 7[37 aa]	D	100.0 /100.0	7 /7	R1AB_SARS2 Non-structural protein 8
	6nus[1]	A	R1AB_CVHSA NSP12[715 aa]	B	100.0 /96.4	40 /40	R1A_CVHSA NSP8
	3ub0[2]	B	R1AB_FIPV Non-structural protein 7, nsp7[82 aa]	A	33.3 /42.7	12 /12	R1AB_FIPV Non-structural protein 6, nsp6,
	3ub0[2]	C	R1AB_FIPV Non-structural protein 7, nsp7[82 aa]	A	61.3 /42.7	31 /31	R1AB_FIPV Non-structural protein 6, nsp6,
	8g6r[1]	A	A0A0U2C263_9ALPC nsp12[899 aa]	B	50.0 /38.4	42 /42	A0A1Z2R8Q6_9ALPC nsp8
	8g6r[1]	C	A0A0M4AW09_9ALPC nsp7[62 aa]	B	50.0 /38.4	2 /2	A0A1Z2R8Q6_9ALPC nsp8
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
198	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6xez[18]	G	Product RNA	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	6xez[2]	H	Template RNA	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	6yyt[4]	F	RNA product	B	100.0 /100.0	4 /4	R1AB_SARS2 nsp8
	6yyt[1]	G	RNA product	D	100.0 /100.0	3 /3	R1AB_SARS2 nsp8
	7c2k[1]	E	RNA (29-MER)	D	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	7cxm[24]	E	RNA (25-MER)	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	7cxm[4]	F	RNA (26-MER)	B	100.0 /100.0	1 /1	R1AB_SARS2 Non-structural protein 8
	7cyq[2]	E	Primer	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	7cyq[1]	F	Template	B	100.0 /100.0	1 /1	R1AB_SARS2 Non-structural protein 8
	7cyq[1]	F	Template	D	100.0 /100.0	6 /6	R1AB_SARS2 Non-structural protein 8
	7dok[2]	A	RNA (5'-R(PGPCPUPAPUPGPUPGPAPGPAPUP*UP..	D	100.0 /100.0	1 /1	R1AB_SARS2 Non-structural protein 8
	7ed5[1]	E	RNA (5'-R(PGPCPUPAPUPGPUPGPAPGPAPUP*UP..	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	7ed5[1]	E	RNA (5'-R(PGPCPUPAPUPGPUPGPAPGPAPUP*UP..	D	100.0 /100.0	5 /5	R1AB_SARS2 Non-structural protein 8
	7dok[1]	B	RNA (5'-R(PCPCPCPUPAPUPAPAPCPUPUPAP*AP..	F	100.0 /100.0	5 /5	R1AB_SARS2 Non-structural protein 8
	7dte[2]	E	RNA (57-MER)	B	100.0 /100.0	3 /3	R1AB_SARS2 Non-structural protein 8
	7dte[2]	F	RNA (33-MER)	B	100.0 /100.0	6 /6	R1AB_SARS2 Non-structural protein 8
	7ed5[1]	F	RNA (5'-R(PCPCPCPCPAPUPAPAPCPUPUPAP*AP..	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	7ed5[1]	F	RNA (5'-R(PCPCPCPCPAPUPAPAPCPUPUPAP*AP..	D	100.0 /100.0	6 /6	R1AB_SARS2 Non-structural protein 8
	7egq[3]	T	Template RNA	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	7eiz[2]	H	template	B	100.0 /100.0	1 /1	R1AB_SARS2 Non-structural protein 8
	7krn[6]	F	RNA (37-MER)	B	100.0 /100.0	5 /5	R1AB_SARS2 Non-structural protein 8
	7krn[4]	G	RNA (43-MER)	B	100.0 /100.0	4 /4	R1AB_SARS2 Non-structural protein 8
	7krp[2]	F	RNA (36-MER)	B	100.0 /100.0	3 /3	R1AB_SARS2 Non-structural protein 8
	7rdx[2]	H	Template RNA	B	100.0 /100.0	5 /5	R1AB_SARS2 Non-structural protein 8
	7rdy[2]	H	Template RNA	B	100.0 /100.0	3 /3	R1AB_SARS2 Non-structural protein 8
	7rdz[12]	H	Template RNA	B	100.0 /100.0	4 /4	R1AB_SARS2 Non-structural protein 8
	7uo4[2]	E	Product RNA (35-MER)	B	100.0 /100.0	3 /3	R1AB_SARS2 Non-structural protein 8
	7uo4[2]	F	Template RNA (55-MER)	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	7uo7[2]	D	Product RNA (35-MER)	B	100.0 /100.0	3 /3	R1AB_SARS2 Non-structural protein 8
	7uo7[2]	E	Template RNA (55-MER)	B	100.0 /100.0	3 /3	R1AB_SARS2 Non-structural protein 8
	7uo9[2]	D	Product RNA (35-MER)	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	7uo9[2]	E	Template RNA (55-MER)	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	7uob[4]	E	Product RNA (35-MER)	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	7uob[2]	F	Template RNA (55-MER)	B	100.0 /100.0	3 /3	R1AB_SARS2 Non-structural protein 8
	7uoe[2]	F	Template RNA (55-MER)	B	100.0 /100.0	4 /4	R1AB_SARS2 Non-structural protein 8
	8gwb[14]	F	template	B	100.0 /100.0	1 /1	R1AB_SARS2 Non-structural protein 8
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
198	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7krn[9]	T	1N7 CHAPSO[36 atoms]	D	100.0 /100.0	3 /3	R1AB_SARS2 Non-structural protein 8
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
198	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	2ahm[12]	E	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa]	E	100.0 /97.4	19 /19	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	2ahm[4]	G	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa]	E	100.0 /97.4	8 /8	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	2ahm[6]	H	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[191 aa]	E	100.0 /97.4	5 /5	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	2ahm[4]	E	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa]	G	100.0 /97.4	7 /7	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	2ahm[2]	E	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain[155 aa]	H	100.0 /97.4	7 /7	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
198	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6wqd[2]	F	EDO 1,2-ETHANEDIOL[4 atoms]	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	6wqd[3]	G	EDO 1,2-ETHANEDIOL[4 atoms]	B	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	6xip[1]	F	EDO 1,2-ETHANEDIOL[4 atoms]	B	100.0 /100.0	7 /7	R1AB_SARS2 Non-structural protein 8
	6wtc[1]	E	ACY ACETIC ACID[4 atoms]	B	100.0 /100.0	4 /4	R1AB_SARS2 Non-structural protein 8
	6wtc[1]	F	ACY ACETIC ACID[4 atoms]	D	100.0 /100.0	2 /2	R1AB_SARS2 Non-structural protein 8
	2ahm[2]	N	SO4 SULFATE ION[5 atoms]	H	75.0 /97.4	4 /4	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	2ahm[6]	I	GOL GLYCEROL[6 atoms]	E	100.0 /97.4	2 /2	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	2ahm[6]	I	GOL GLYCEROL[6 atoms]	E	100.0 /97.4	1 /1	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	2ahm[4]	J	GOL GLYCEROL[6 atoms]	E	100.0 /97.4	3 /3	R1AB_CVHSA Replicase polyprotein 1ab, heavy chain
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [YP_009725304.1()]