#WARNING:no index is registered index "YP_009725300.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725300.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1698673 500 9 YP_009725300.1()
QUERYSEQ 
KIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSAC
VLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYY
FMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNK
YKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725300.1()]

500
region name description
1-500 DISORDER predicted by DISOPRED

MONOMER
500
pdb_id a1 identity[%]2 description
3vcb A 61.4 Q9J3E9_9BETC RNA-directed RNA polymerase 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HOMO
500 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3vc8[2] B Q9J3E9_9BETC RNA-directed RNA polymerase[85 aa] A 75.0
/64.1		 4
/4		 Q9J3E9_9BETC RNA-directed RNA polymerase
3vcb[2] B Q9J3E9_9BETC RNA-directed RNA polymerase[89 aa] A 60.9
/61.4		 23
/23		 Q9J3E9_9BETC RNA-directed RNA polymerase
3gzf[4] C R1AB_FIPV Replicase polyprotein 1ab[92 aa] A 37.5
/40.4		 16
/16		 R1AB_FIPV Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
500 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3gzf[2] F SO4
SULFATE ION[5 atoms] 		C 50.0
/41.1		 4
/4		 R1AB_FIPV Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.