#WARNING:no index is registered index 'YP_009725299.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
22554 1945 500 YP_009725299.1()
QUERYSEQ
APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAA
LQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVV
GPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSA
TLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDY
GARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTI
KVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYC
NKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFY
KENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKP
VETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNY
MPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDL
TAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDE
VARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEA
ELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725299.1()]

1945
region name description
1-1945 DISORDER predicted by DISOPRED (1-3,111-137,139-209,378-414,1066-1066,1211-1233,1235-1236,1239-1239,1822-1833,1931-1931,1935-1945)

MONOMER
1945
pdb_id a1 identity[%]2 description
6wuu A 99.7 R1AB_SARS2 papain-like protease
2w2g A 76.3 R1A_CVHSA NON-STRUCTURAL PROTEIN 3
6z6i C 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7kag A 100.0 R1AB_SARS2 Non-structural protein 3
2k87 A 81.7 R1A_CVHSA Non-structural protein 3 of Replicase polyprotein 1a
2kaf A 77.4 R1A_CVHSA Non-structural protein 3
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6wx4[5] B VIR251[5 aa] A 100.0
/99.7
16
/16
R1AB_SARS2 Non-structural protein 3
6yva[1] B ISG15_MOUSE Ubiquitin-like protein ISG15[155 aa] A 96.6
/99.6
29
/29
R1A_SARS2 Replicase polyprotein 1a
5w8t[4] C ISG15_HUMAN Ubiquitin-like protein ISG15[77 aa] D 34.6
/31.4
26
/26
K0BWD0_9BETC ORF1ab
6xa9[5] D ISG15_HUMAN ISG15 CTD-propargylamide[79 aa] C 100.0
/100.0
22
/22
R1AB_SARS2 Papain-like protease
5tl7[2] A ISG15_MOUSE Ubiquitin-like protein ISG15[77 aa] B 92.6
/82.9
27
/27
R1AB_CVHSA Replicase polyprotein 1ab
6bi8[2] D ISG15_HUMAN Ubiquitin-like protein ISG15[153 aa] B 39.3
/31.5
28
/28
K4LC41_9BETC ORF1a
5v69[2] B ME.4[72 aa] A 30.4
/31.4
23
/23
K0BWD0_9BETC MERS-CoV PLpro
5e6j[2] F UBB_HUMAN Polyubiquitin-B[75 aa] D 70.0
/82.7
10
/10
R1AB_CVHSA Replicase polyprotein 1ab
6xaa[7] B J3QS39_HUMAN Ubiquitin-propargylamide[76 aa] A 100.0
/100.0
25
/25
R1AB_SARS2 Papain-like protease
5bz0[3] B RS27A_BOVIN Ubiquitin-40S ribosomal protein S27a[76 aa] A 23.8
/25.3
21
/33
R1AB_IBVB Replicase polyprotein 1ab
4wur[1] B UBB_HUMAN Polyubiquitin-B[74 aa] A 39.1
/31.1
23
/23
R1AB_CVEMC Papain-like protease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5run[1] C EXB
3-(1H-benzimidazol-1-yl)propanoic acid[14 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5ruf[1] C 54T
6-chloro-1,3-benzothiazol-2-amine[11 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rty[1] C HBD
4-HYDROXYBENZAMIDE[10 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rvm[1] B HBD
4-HYDROXYBENZAMIDE[10 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rti[1] C 6U6
3-(5-chloranyl-1,3-benzothiazol-2-yl)propanoic aci..
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5rvb[1] C 7PD
2-aminopteridine-4,7(3H,8H)-dione[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5rto[1] C 4PN
4-PIPERIDINO-PIPERIDINE[12 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
5rsu[1] C OHB
salicylamide[10 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rus[1] C HSM
HISTAMINE[8 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rv3[1] C MYI
(5-methoxy-1H-indol-3-yl)acetic acid[15 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5rtp[1] C AOT
2-oxidanylidene-2-phenylazanyl-ethanoic acid[12 at..
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rv4[1] C 4FS
quinolin-3-amine[11 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rtu[1] C 1FF
1-methyl-5-phenyl-1H-pyrazole-4-carboxylic acid[15..
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rtm[1] C PZA
PYRAZINE-2-CARBOXAMIDE[9 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rte[1] C 4FL
4-(1H-imidazol-2-yl)pyridine[11 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5ru9[1] C 4SV
3-AMINOPYRIDINE-4-CARBOXYLIC ACID[10 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rt9[1] C 54G
2-hydroxy-5-methylbenzoic acid[11 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rst[1] C 5HN
5-hydroxypyridine-3-carboxylic acid[10 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5ruz[1] C W6S
4-(1H-pyrazol-3-yl)piperidine[11 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Non-structural protein 3
5rux[1] C W6P
1,3-dihydro-2H-indol-2-one[10 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
5rv0[1] C W6V
N-(1,3-thiazol-2-yl)benzamide[14 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rv8[1] C 8EJ
6-methylpyridine-3-carboxamide[10 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5ruv[1] C W6J
1-(pyridin-2-yl)-1,4-diazepane[13 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rsy[1] C 3R6
2-hydroxy-5-(methylsulfanyl)benzoic acid[12 atoms]..
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5ruy[1] C XAN
XANTHINE[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5ruw[1] C W6M
3-{[(3-methyl-1,2,4-oxadiazol-5-yl)methyl]carbamoy..
A 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 3
5rsr[1] C XIY
2-HYDROXYMETHYL-BENZOIMIDAZOLE[11 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5ruo[1] C W6A
4-chloro-1H-indole-2-carboxylic acid[13 atoms]
A 100.0
/100.0
11
/11
R1AB_SARS2 Non-structural protein 3
5ruu[1] C W6G
N-(1,3,4-thiadiazol-2-yl)benzenesulfonamide[15 ato..
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5ruq[1] C W6D
1H-indole-4-carboxamide[12 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
5rv7[1] C JNZ
1H-indazol-3-amine[10 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5ru0[1] C 2CL
(2,6-DICHLOROPHENYL)ACETIC ACID[12 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 3
5ru0[1] D 2CL
(2,6-DICHLOROPHENYL)ACETIC ACID[12 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5rvl[1] B BVF
4-METHYLPYRIDIN-2-AMINE[8 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rso[1] C TYZ
PARA ACETAMIDO BENZOIC ACID[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rtj[1] C PHB
P-HYDROXYBENZOIC ACID[10 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5ru7[1] C PYD
2,5-DIMETHYL-PYRIMIDIN-4-YLAMINE[9 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rut[1] C APG
ATROLACTIC ACID (2-PHENYL-LACTIC ACID)[12 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rv9[2] D EKZ
4-tert-butylbenzene-1,2-diol[12 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rua[1] C 3EU
(3,5-dichlorophenyl)acetic acid[12 atoms]
A 100.0
/100.0
11
/11
R1AB_SARS2 Non-structural protein 3
5rvr[1] B LZ1
1H-indazole[9 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5rvk[1] B 2AK
7-bromo-5-methyl-1H-indole-2,3-dione[13 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rsn[1] C 51X
(1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)acetic aci..
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5ru3[1] C 8H8
2-fluoro-4-hydroxybenzonitrile[10 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
7jme[1] B CMP
ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE[22 atoms]
A 100.0
/100.0
16
/16
R1AB_SARS2 Non-structural protein 3
5rsp[1] C LSA
1,2-BENZISOTHIAZOL-3(2H)-ONE 1,1-DIOXIDE[12 atoms]..
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rt3[1] C 2FX
1-benzothiophen-2-ylacetic acid[13 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 Non-structural protein 3
7cmd[7] I TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
B 100.0
/100.0
10
/10
R1AB_SARS2 Replicase polyprotein 1ab
7jir[2] B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
5rv5[1] C JG8
BENZOFURO[3,2-D]PYRIMIDIN-4(3H)-ONE[14 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rup[1] C 04R
[3-(trifluoromethyl)-4,5,6,7-tetrahydro-1H-indazol..
A 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 3
5rt2[1] C 5OF
2-(4-oxidanylidene-3~{H}-phthalazin-1-yl)ethanoic ..
A 100.0
/100.0
10
/10
R1AB_SARS2 Non-structural protein 3
5rvh[1] C Q3C
quinoline-3-carboxylic acid[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rum[1] C 52F
3-(3-oxo-3,4-dihydroquinoxalin-2-yl)propanoic acid..
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rv6[1] C 0HN
1,3-benzodioxole-5-carboxylic acid[12 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5rsx[1] C YTX
2-(3-methoxy-4-oxidanyl-phenyl)ethanoic acid[13 at..
A 100.0
/100.0
12
/12
R1AB_SARS2 Non-structural protein 3
5rth[1] C 3BZ
3-chlorobenzoate[10 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rtr[1] C SHA
SALICYLHYDROXAMIC ACID[11 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rtd[1] C MHW
3-HYDROXYPICOLINIC ACID[10 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rui[1] C 4YS
isoquinolin-1(2H)-one[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5ruk[1] C NVU
2-(1,2-benzoxazol-3-yl)ethanoic acid[13 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rvu[1] B 6P3
6-phenylpyridine-3-carboxylic acid[15 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 3
6z6i[1] O MPO
3[N-MORPHOLINO]PROPANE SULFONIC ACID[13 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
5rvn[1] B ANN
4-METHOXYBENZOIC ACID[11 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rt8[1] C HLR
1,2-benzoxazol-3-amine[10 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rvf[1] C W8D
3-{[(2R)-oxolan-2-yl]methyl}-3H-purin-6-amine[16 a..
A 100.0
/100.0
10
/10
R1AB_SARS2 Non-structural protein 3
5rtz[1] C FHB
3-FLUORO-4-HYDROXYBENZOIC ACID[11 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rve[1] C W8A
{[(2S)-1-oxo-1-(2-oxoimidazolidin-1-yl)propan-2-yl..
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rvg[1] D W8J
3-{3-[(3S)-oxolan-3-yl]propyl}-3H-purin-6-amine[18..
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rvg[1] C W8J
3-{3-[(3S)-oxolan-3-yl]propyl}-3H-purin-6-amine[18..
A 100.0
/100.0
12
/12
R1AB_SARS2 Non-structural protein 3
5rsc[1] C W5S
7-[(furan-2-yl)methyl]-5,6-dimethyl-7H-pyrrolo[2,3..
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5rse[1] C W5P
4-[(3R)-3-fluoropiperidin-1-yl]-7H-pyrrolo[2,3-d]p..
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5rul[1] C 5ZE
4,6-dimethylpyrimidin-2-amine[9 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rtk[1] C BZX
1,3-benzodioxol-5-ol[10 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5rsj[1] C W5A
3-[(2-methyl-1,3-thiazol-4-yl)methyl]-3H-purin-6-a..
A 100.0
/100.0
12
/12
R1AB_SARS2 Non-structural protein 3
5rsh[1] C W5G
4-(5-azaspiro[2.5]octan-5-yl)-7H-pyrrolo[2,3-d]pyr..
A 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 3
5rtf[1] C ISN
ISATIN[11 atoms]
B 100.0
/100.0
2
/3
R1AB_SARS2 Non-structural protein 3
5rsi[1] C W5D
4-(1,4-oxazonan-4-yl)-7H-pyrrolo[2,3-d]pyrimidine[..
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rsg[1] C W5J
N-methyl-N-7H-pyrrolo[2,3-d]pyrimidin-4-yl-beta-al..
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5rsf[1] C W5M
9-methyl-9H-purine-2,6-diamine[12 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rv2[1] C W7S
N-benzylpyrazine-2-carboxamide[16 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 3
5ru2[1] C 06Y
2-phenoxyethanoic acid[11 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rtl[1] C 4J8
4-methylbenzenesulfonamide[11 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rsz[1] C ZZA
1-PHENYL-1H-PYRAZOLE-4-CARBOXYLIC ACID[14 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rvq[1] B 4BY
5-methyl-1H-indole-2-carboxylic acid[13 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 3
5rt4[1] C 4BX
3-(1H-benzimidazol-2-yl)propanoic acid[14 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rud[1] C 2D0
4-chloro-1,3-benzothiazol-2-amine[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rtq[1] C 4JO
5-bromo-6-methylpyridin-2-amine[9 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rsd[1] C 1LQ
quinazolin-4-amine[11 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rvj[1] B 4JQ
6-amino-2H-chromen-2-one[12 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rvp[1] B 1SQ
ISOQUINOLIN-1-AMINE[11 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5ru8[1] C 1SQ
ISOQUINOLIN-1-AMINE[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rvt[1] B 4BL
6-methyl-1H-indole-2-carboxylic acid[13 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rt0[1] C 4BL
6-methyl-1H-indole-2-carboxylic acid[13 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
5rvi[1] D CLW
CHLORZOXAZONE[11 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rvi[1] C CLW
CHLORZOXAZONE[11 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 3
5ru1[1] C DFA
DIPHENYLACETIC ACID[16 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Non-structural protein 3
5rsm[1] C 4SO
4-sulfamoylbenzoic acid[13 atoms]
A 100.0
/100.0
10
/10
R1AB_SARS2 Non-structural protein 3
5rsl[1] C W51
6-[(1s,4s)-2-azabicyclo[2.2.2]octan-2-yl]-5-chloro..
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5rsk[1] C W57
3-[(3-methoxy-1,2-oxazol-5-yl)methyl]-3H-purin-6-a..
A 100.0
/100.0
11
/11
R1AB_SARS2 Non-structural protein 3
5ru4[1] C 6V9
2-methyl-1,3-thiazole-5-carboxylic acid[9 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rtw[1] C OHP
(2-HYDROXYPHENYL)ACETIC ACID[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rur[1] C FBB
6-fluoro-1,3-benzothiazol-2-amine[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rsw[1] C 6FZ
2,3-dihydro-1H-indene-2-carboxylic acid[12 atoms]
A 100.0
/100.0
10
/10
R1AB_SARS2 Non-structural protein 3
5rt6[1] C 05R
2-(3,4-dichlorophenyl)ethanoic acid[12 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 Non-structural protein 3
5rtt[1] C NMI
3-(1-methyl-1H-indol-3-yl)propanoic acid[15 atoms]..
A 100.0
/100.0
12
/12
R1AB_SARS2 Non-structural protein 3
5rvc[1] C W7V
(1R,5R)-N-methyl-N-(1H-pyrazol-4-yl)bicyclo[3.1.0]..
A 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
5ruj[1] C 2SX
(5-bromo-1H-indol-3-yl)acetic acid[14 atoms]
A 100.0
/100.0
10
/10
R1AB_SARS2 Non-structural protein 3
7kqp[1] C AR6
[(2R,3S,4R,5R)-5-(6-AMINOPURIN-9-YL)-3,4-DIHYDROXY..
A 100.0
/100.0
23
/23
R1AB_SARS2 Non-structural protein 3
6z72[4] M A3R
Adenosine Diphosphate (Hydroxymethyl)pyrrolidine m..
C 100.0
/100.0
20
/20
R1AB_SARS2 Replicase polyprotein 1ab
5rtb[1] C 3XH
3-Hydroxyhippuric acid[14 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rss[1] C NC3
N-[(CYCLOHEXYLAMINO)CARBONYL]GLYCINE[14 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rvd[1] C W7Y
4-[(2R)-2-cyclobutylpyrrolidin-1-yl]-7H-pyrrolo[2,..
A 100.0
/100.0
12
/12
R1AB_SARS2 Non-structural protein 3
5ruh[1] C KNL
(2,6-dichlorophenoxy)acetic acid[13 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5ru5[1] C BXW
3-oxo-3,4-dihydro-2H-1,4-benzothiazine-7-carboxyli..
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rtc[1] C EVE
1H-benzimidazole-2-sulfonamide[13 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rtv[1] C PF0
3-hydroxy-2-methylbenzoic acid[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rta[1] C Q6T
1,3-benzodioxole-4-carboxylic acid[12 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rva[1] C HQD
3-HYDROXY-2-METHYLQUINOLIN-4(1H)-ONE[13 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
4m0w[1] F NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 83.3
/82.3
6
/6
R1A_CVHSA Replicase polyprotein 1a
4m0w[1] E NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 85.7
/82.3
7
/7
R1A_CVHSA Replicase polyprotein 1a
6vxs[2] D NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rsq[1] C MOK
5-methyl-3-phenyl-1,2-oxazole-4-carboxylic acid[15..
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5rsv[1] C 4MB
4-[(METHYLSULFONYL)AMINO]BENZOIC ACID[14 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rs8[1] C H35
N-(FURAN-2-YLMETHYL)-7H-PURIN-6-AMINE[16 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rvo[1] B AQO
2-AMINOQUINAZOLIN-4(3H)-ONE[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rtn[1] C AQO
2-AMINOQUINAZOLIN-4(3H)-ONE[12 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rtg[1] C 3HP
3-HYDROXYPHENYLACETATE[11 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5rt7[1] C GVH
1H-PYRROLO[2,3-B]PYRIDINE[9 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rsb[1] C W4S
7-methyl-7H-pyrrolo[2,3-d]pyrimidin-4-amine[11 ato..
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rs9[1] C W4V
6,7-dihydro-5H-cyclopenta[d][1,2,4]triazolo[1,5-a]..
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6z6i[5] R A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID..
C 100.0
/100.0
23
/23
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] X A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID..
C 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
5rs7[1] C W4Y
1-{2-[(propan-2-yl)oxy]ethyl}-2-sulfanylidene-1,2,..
A 100.0
/100.0
11
/11
R1AB_SARS2 Non-structural protein 3
5rtx[1] C 6OT
3,5-dichlorobenzene-1-sulfonamide[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rug[1] C NOA
NAPHTHYLOXYACETIC ACID[15 atoms]
A 100.0
/100.0
11
/11
R1AB_SARS2 Non-structural protein 3
6z72[1] R MLT
D-MALATE[9 atoms]
D 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
5rvs[1] B 0LO
5-phenylpyridine-3-carboxylic acid[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5rts[1] C 0LO
5-phenylpyridine-3-carboxylic acid[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 3
5ru6[1] C 2UP
naphthalene-2-carboximidamide[13 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5rvv[1] B WB1
6-methyl-1H-indole-3-carboxylic acid[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Non-structural protein 3
5rue[1] C BHA
2-HYDROXY-4-AMINOBENZOIC ACID[11 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5rv1[1] C TFA
trifluoroacetic acid[7 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rt1[1] C 3A9
2,3-dihydro-1-benzofuran-5-carboxylic acid[12 atom..
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
5ruc[1] C NCA
NICOTINAMIDE[9 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
5rt5[1] C 07L
7-hydroxy-2H-chromen-2-one[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
7d7t[2] F GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen..
A 100.0
/99.7
6
/6
R1A_SARS2 papain-like protease
7d7t[2] D GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen..
A 100.0
/99.7
9
/9
R1A_SARS2 papain-like protease
7jit[1] B Y95
5-[(carbamoylcarbamoyl)amino]-2-methyl-N-[(1R)-1-(..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
7koj[1] B Y94
2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]-5-{[(pr..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
7kol[2] B Y96
5-[(E)-(hydroxyimino)methyl]-2-methyl-N-[(1R)-1-(n..
A 100.0
/100.0
11
/11
R1A_SARS2 Papain-Like Protease
7jiw[2] B VBY
5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1..
A 100.0
/100.0
11
/11
R1A_SARS2 Papain-Like Protease
7jn2[2] B Y41
3-amino-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]..
A 100.0
/100.0
10
/10
R1A_SARS2 Papain-Like Protease
4ow0[2] I S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
B 100.0
/81.1
10
/10
R1A_CVHSA papain-like protease
4ovz[2] G P85
N-[(4-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
B 100.0
/81.3
11
/11
R1A_CVHSA Papain-like proteinase
3mj5[2] C GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
A 100.0
/82.7
9
/9
R1A_CVHSA Replicase polyprotein 1a
3mj5[2] E GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
A 100.0
/82.7
4
/4
R1A_CVHSA Replicase polyprotein 1a
5zub[3] B NAD
NICOTINAMIDE-ADENINE-DINUCLEOTIDE[44 atoms]
A 77.3
/44.4
22
/22
T2B9G2_9BETC ORF1a
6men[2] C ADQ
ADENOSINE-5'-DIPHOSPHATE-GLUCOSE[38 atoms]
A 84.2
/48.8
19
/21
R1AB_BCHK4 Replicase polyprotein 1ab
6w6y[1] C AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 100.0
/100.0
16
/16
R1AB_SARS2 Non-structural protein 3
5zu7[1] B AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 61.5
/44.4
13
/13
T2B9G2_9BETC ORF1a
5zua[1] B ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
A 61.5
/44.4
13
/13
T2B9G2_9BETC ORF1a
4d86[1] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 50.0
/36.3
10
/12
PAR14_HUMAN Poly [ADP-ribose] polymerase 14
5zu9[1] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 66.7
/44.4
15
/15
T2B9G2_9BETC ORF1a
3gqe[1] C BCN
BICINE[11 atoms]
A 87.5
/40.4
8
/8
POLN_EEVVP Non-structural protein 3
6woj[65] H APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
D 100.0
/100.0
23
/23
R1AB_SARS2 Non-structural protein 3
3gqo[5] F APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
B 77.8
/40.4
18
/22
POLN_EEVVP Non-structural protein 3
3q6z[1] B APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms]
A 55.6
/34.5
18
/18
PAR14_HUMAN Poly [ADP-ribose] polymerase 14
5cb5[2] UA ZOD
[(2R,3R,4R,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin..
N 52.4
/34.0
21
/21
YMDB_ECOLI O-acetyl-ADP-ribose deacetylase
3ew5[3] K 1GP
SN-GLYCEROL-1-PHOSPHATE[10 atoms]
B 80.0
/33.1
10
/10
R1AB_FIPV macro domain of Non-structural protein 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5y3q[2] H NA
SODIUM ION[1 atoms]
A 100.0
/82.8
7
/7
R1A_CVHSA Replicase polyprotein 1a
5y3q[3] D NA
SODIUM ION[1 atoms]
A 100.0
/82.8
4
/4
R1A_CVHSA Replicase polyprotein 1a
6z5t[6] F NA
SODIUM ION[1 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] K NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
4m0w[1] D NA
SODIUM ION[1 atoms]
A 20.0
/82.3
5
/5
R1A_CVHSA Replicase polyprotein 1a
5y3q[2] F NA
SODIUM ION[1 atoms]
A 83.3
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
6z6i[3] Q NA
SODIUM ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] Z NA
SODIUM ION[1 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 Replicase polyprotein 1ab
5y3e[2] D NA
SODIUM ION[1 atoms]
A 40.0
/82.8
5
/5
R1A_CVHSA Replicase polyprotein 1a
5y3e[4] F NA
SODIUM ION[1 atoms]
A 100.0
/82.8
3
/3
R1A_CVHSA Replicase polyprotein 1a
6z6i[1] AA NA
SODIUM ION[1 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[1] KA NA
SODIUM ION[1 atoms]
D 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6ywk[2] I MG
MAGNESIUM ION[1 atoms]
C 100.0
/100.0
1
/4
R1AB_SARS2 NSP3 macrodomain
6wuu[1] P MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
2
/2
R1AB_SARS2 papain-like protease
6ywm[1] O MG
MAGNESIUM ION[1 atoms]
C 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
6wuu[1] K MG
MAGNESIUM ION[1 atoms]
B 100.0
/99.4
1
/1
R1AB_SARS2 papain-like protease
6wuu[1] M MG
MAGNESIUM ION[1 atoms]
C 100.0
/99.7
1
/1
R1AB_SARS2 papain-like protease
6wuu[1] O MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
5
/5
R1AB_SARS2 papain-like protease
7kok[18] H CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7jir[9] G CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
6
/6
R1A_SARS2 Papain-like protease
6wzu[3] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
5v6a[1] G CL
CHLORIDE ION[1 atoms]
A 0.0
/31.4
4
/4
K0BWD0_9BETC MERS-CoV PLpro
7jn2[3] K CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1A_SARS2 Papain-Like Protease
5v6a[5] I CL
CHLORIDE ION[1 atoms]
A 50.0
/31.4
2
/2
K0BWD0_9BETC MERS-CoV PLpro
3ew5[2] I CL
CHLORIDE ION[1 atoms]
B 100.0
/33.1
1
/1
R1AB_FIPV macro domain of Non-structural protein 3
6w9c[3] E CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
7
/7
R1A_SARS2 Papain-like proteinase
3ew5[2] N CL
CHLORIDE ION[1 atoms]
C 0.0
/33.1
1
/1
R1AB_FIPV macro domain of Non-structural protein 3
5v6a[1] F CL
CHLORIDE ION[1 atoms]
A 100.0
/31.4
2
/2
K0BWD0_9BETC MERS-CoV PLpro
3e9s[1] E CL
CHLORIDE ION[1 atoms]
A 75.0
/82.7
4
/4
R1A_CVHSA Non-structural protein 3
3jzt[1] I CL
CHLORIDE ION[1 atoms]
A 0.0
/33.1
1
/1
R1AB_FIPV macro domain of Non-structural protein 3
6wen[1] B CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
7koj[19] S UNX
UNKNOWN ATOM OR ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
7koj[11] R UNX
UNKNOWN ATOM OR ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
7d47[1] D CA
CALCIUM ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Non-structural protein 3
7d47[1] F CA
CALCIUM ION[1 atoms]
B 75.0
/99.7
4
/4
R1A_SARS2 Non-structural protein 3
7jit[9] F ZN
ZINC ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
3mj5[72] F ZN
ZINC ION[1 atoms]
B 66.7
/81.3
6
/6
R1A_CVHSA Replicase polyprotein 1a
7cmd[1] K ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
7jit[7] D ZN
ZINC ION[1 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
5w8u[7] N ZN
ZINC ION[1 atoms]
A 0.0
/31.4
1
/1
K0BWD0_9BETC ORF1ab
4wur[5] E ZN
ZINC ION[1 atoms]
A 80.0
/31.1
5
/5
R1AB_CVEMC Papain-like protease
7cjm[1] C ZN
ZINC ION[1 atoms]
A 100.0
/99.7
1
/1
R1AB_SARS2 Non-structural protein 3
5wfi[2] N ZN
ZINC ION[1 atoms]
B 100.0
/31.1
4
/4
R1AB_CVMA5 papain-like protease
7cjm[1] D ZN
ZINC ION[1 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
4ypt[7] B ZN
ZINC ION[1 atoms]
A 100.0
/31.2
4
/4
R1AB_CVMA5 Replicase polyprotein 1ab
7kol[3] F ZN
ZINC ION[1 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Papain-Like Protease
7jit[9] E ZN
ZINC ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
5w8u[4] F ZN
ZINC ION[1 atoms]
A 0.0
/31.4
4
/4
K0BWD0_9BETC ORF1ab
5ko3[1] B ZN
ZINC ION[1 atoms]
A 80.0
/31.0
5
/5
A0A023J538_9BETC ORF1a
5bz0[1] C ZN
ZINC ION[1 atoms]
A 75.0
/25.3
4
/4
R1AB_IBVB Replicase polyprotein 1ab
3mp2[1] B ZN
ZINC ION[1 atoms]
A 60.0
/30.1
5
/5
R1A_CVPPU Non-structural protein 3
4x2z[1] B ZN
ZINC ION[1 atoms]
A 75.0
/25.0
4
/4
R1AB_IBVB Nonstructural protein 3
6bi8[3] F ZN
ZINC ION[1 atoms]
A 100.0
/31.5
4
/4
K4LC41_9BETC ORF1a
7cmd[1] G ZN
ZINC ION[1 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
7cmd[1] L ZN
ZINC ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
2fe8[6] O BR
BROMIDE ION[1 atoms]
C 75.0
/82.7
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] P BR
BROMIDE ION[1 atoms]
C 100.0
/82.7
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] L BR
BROMIDE ION[1 atoms]
B 100.0
/82.7
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
5e6j[1] H NI
NICKEL (II) ION[1 atoms]
A 0.0
/82.0
2
/2
R1AB_CVHSA Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7kag[2] A R1AB_SARS2 Non-structural protein 3[111 aa] B 100.0
/100.0
12
/12
R1AB_SARS2 Non-structural protein 3
7cjd[14] B R1AB_SARS2 Replicase polyprotein 1ab[297 aa] D 100.0
/99.7
14
/14
R1AB_SARS2 Replicase polyprotein 1ab
7d7t[2] B R1A_SARS2 papain-like protease[315 aa] A 100.0
/99.7
22
/22
R1A_SARS2 papain-like protease
6xg3[2] A R1AB_SARS2 Peptidase C16[313 aa] A 100.0
/99.7
24
/24
R1AB_SARS2 Peptidase C16
7cjd[2] D R1AB_SARS2 Replicase polyprotein 1ab[310 aa] A 100.0
/99.7
14
/14
R1AB_SARS2 Replicase polyprotein 1ab
2fe8[6] A R1AB_CVHSA Replicase polyprotein 1ab[315 aa] C 87.5
/82.7
16
/16
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] C 75.0
/82.7
8
/9
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[8] A R1AB_CVHSA Replicase polyprotein 1ab[315 aa] B 75.0
/82.7
16
/16
R1AB_CVHSA Replicase polyprotein 1ab
2wct[6] C R1A_CVHSA NON-STRUCTURAL PROTEIN 3[252 aa] B 79.2
/76.3
24
/24
R1A_CVHSA NON-STRUCTURAL PROTEIN 3
3ewp[2] B R1A_IBVM Non-structural protein 3[168 aa] A 0.0
/31.9
11
/16
R1A_IBVM Non-structural protein 3
3ewp[1] A R1A_IBVM Non-structural protein 3[177 aa] B 12.5
/31.9
16
/16
R1A_IBVM Non-structural protein 3
4p16[2] A K4LC41_9BETC ORF1a[315 aa] A 28.6
/31.5
28
/28
K4LC41_9BETC ORF1a
4pt5[4] A K4LC41_9BETC Papain-like protease[321 aa] A 26.5
/31.3
34
/34
K4LC41_9BETC Papain-like protease
4ypt[3] A R1AB_CVMA5 Replicase polyprotein 1ab[378 aa] A 22.2
/31.2
18
/20
R1AB_CVMA5 Replicase polyprotein 1ab
4ypt[3] A R1AB_CVMA5 Replicase polyprotein 1ab[378 aa] A 50.0
/31.2
22
/22
R1AB_CVMA5 Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1945 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7kg3[1] C MLI
MALONATE ION[7 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
7kg3[1] B MLI
MALONATE ION[7 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6ywk[8] AA EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
4
/4
R1AB_SARS2 NSP3 macrodomain
6ywk[28] N EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 NSP3 macrodomain
6ywk[7] FA EDO
1,2-ETHANEDIOL[4 atoms]
E 100.0
/100.0
7
/7
R1AB_SARS2 NSP3 macrodomain
6z72[5] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6ywl[4] O EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 NSP3 macrodomain
7kag[2] P EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
6ywk[8] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 NSP3 macrodomain
6z72[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6z6i[2] U EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
6z72[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Replicase polyprotein 1ab
6ywk[1] EA EDO
1,2-ETHANEDIOL[4 atoms]
E 100.0
/100.0
5
/5
R1AB_SARS2 NSP3 macrodomain
6z72[7] O EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
6
/6
R1AB_SARS2 Replicase polyprotein 1ab
7kag[5] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
7kag[2] N EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
6ywm[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 NSP3 macrodomain
7cjd[1] G EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/99.7
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
2vri[3] B EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/40.8
2
/2
R1A_CVHNL NON-STRUCTURAL PROTEIN 3
6z6i[1] IA EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 Replicase polyprotein 1ab
6ywk[1] Z EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/100.0
1
/1
R1AB_SARS2 NSP3 macrodomain
7kag[1] C EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
5rt6[4] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
4ow0[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
B 50.0
/81.1
2
/2
R1A_CVHSA papain-like protease
4ovz[1] I DMS
DIMETHYL SULFOXIDE[4 atoms]
B 33.3
/81.3
3
/3
R1A_CVHSA Papain-like proteinase
4ovz[3] K DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/81.3
4
/4
R1A_CVHSA Papain-like proteinase
4ow0[1] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 60.0
/82.6
5
/5
R1A_CVHSA papain-like protease
4ovz[1] L DMS
DIMETHYL SULFOXIDE[4 atoms]
B 66.7
/81.3
6
/6
R1A_CVHSA Papain-like proteinase
4ovz[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/81.3
3
/3
R1A_CVHSA Papain-like proteinase
5rtv[1] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
7koj[5] J MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
6ywm[5] N MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
C 100.0
/100.0
9
/9
R1AB_SARS2 NSP3 macrodomain
6wcf[1] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
7kol[2] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
6
/6
R1A_SARS2 Papain-Like Protease
1spv[1] B MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 63.6
/34.0
11
/11
YMDB_ECOLI putative polyprotein/phosphatase
6ywk[2] DA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
E 100.0
/100.0
6
/6
R1AB_SARS2 NSP3 macrodomain
6ywk[1] CA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
E 100.0
/100.0
11
/11
R1AB_SARS2 NSP3 macrodomain
7krx[6] J ACT
ACETATE ION[4 atoms]
A 83.3
/99.7
6
/6
R1A_SARS2 Papain-like protease
7koj[2] L ACT
ACETATE ION[4 atoms]
A 100.0
/99.7
5
/5
R1A_SARS2 Papain-like protease
7jn2[2] L ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-Like Protease
5cb5[2] CB ACT
ACETATE ION[4 atoms]
R 0.0
/34.0
3
/3
YMDB_ECOLI O-acetyl-ADP-ribose deacetylase
5ko3[1] F ACT
ACETATE ION[4 atoms]
A 40.0
/31.0
5
/5
A0A023J538_9BETC ORF1a
5ko3[1] D ACT
ACETATE ION[4 atoms]
A 20.0
/31.0
5
/5
A0A023J538_9BETC ORF1a
5ko3[1] H ACT
ACETATE ION[4 atoms]
A 0.0
/31.0
3
/4
A0A023J538_9BETC ORF1a
5ko3[1] C ACT
ACETATE ION[4 atoms]
A 0.0
/31.0
2
/2
A0A023J538_9BETC ORF1a
5ko3[1] G ACT
ACETATE ION[4 atoms]
A 33.3
/31.0
3
/4
A0A023J538_9BETC ORF1a
5e6j[1] G ACT
ACETATE ION[4 atoms]
A 83.3
/82.0
6
/6
R1AB_CVHSA Replicase polyprotein 1ab
5ko3[1] E ACT
ACETATE ION[4 atoms]
A 100.0
/31.0
2
/2
A0A023J538_9BETC ORF1a
5ko3[1] I ACT
ACETATE ION[4 atoms]
A 85.7
/31.0
7
/7
A0A023J538_9BETC ORF1a
5cb5[1] PA ACT
ACETATE ION[4 atoms]
K 50.0
/34.0
2
/2
YMDB_ECOLI O-acetyl-ADP-ribose deacetylase
5y3q[1] C BME
BETA-MERCAPTOETHANOL[4 atoms]
A 100.0
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
5wfi[8] L GOL
GLYCEROL[6 atoms]
B 0.0
/31.1
2
/2
R1AB_CVMA5 papain-like protease
4ypt[6] G GOL
GLYCEROL[6 atoms]
A 0.0
/31.2
5
/5
R1AB_CVMA5 Replicase polyprotein 1ab
4ypt[3] E GOL
GLYCEROL[6 atoms]
A 28.6
/31.2
7
/7
R1AB_CVMA5 Replicase polyprotein 1ab
5wfi[2] J GOL
GLYCEROL[6 atoms]
B 0.0
/31.1
7
/7
R1AB_CVMA5 papain-like protease
2acf[1] J GOL
GLYCEROL[6 atoms]
C 100.0
/72.9
7
/7
Replicase polyprotein 1ab
2acf[1] F GOL
GLYCEROL[6 atoms]
A 80.0
/73.4
5
/5
Replicase polyprotein 1ab
4ypt[3] F GOL
GLYCEROL[6 atoms]
A 25.0
/31.2
4
/4
R1AB_CVMA5 Replicase polyprotein 1ab
6z6i[3] DA GOL
GLYCEROL[6 atoms]
D 100.0
/100.0
5
/5
R1AB_SARS2 Replicase polyprotein 1ab
4ypt[3] D GOL
GLYCEROL[6 atoms]
A 0.0
/31.2
2
/2
R1AB_CVMA5 Replicase polyprotein 1ab
4ypt[3] D GOL
GLYCEROL[6 atoms]
A 50.0
/31.2
4
/4
R1AB_CVMA5 Replicase polyprotein 1ab
5y3q[2] J GOL
GLYCEROL[6 atoms]
A 100.0
/82.8
6
/6
R1A_CVHSA Replicase polyprotein 1a
5wfi[2] K GOL
GLYCEROL[6 atoms]
B 37.5
/31.1
8
/8
R1AB_CVMA5 papain-like protease
2acf[1] O GOL
GLYCEROL[6 atoms]
C 75.0
/72.9
4
/4
Replicase polyprotein 1ab
2acf[1] K GOL
GLYCEROL[6 atoms]
C 100.0
/72.9
4
/4
Replicase polyprotein 1ab
2acf[2] L GOL
GLYCEROL[6 atoms]
C 50.0
/72.9
2
/2
Replicase polyprotein 1ab
7kg3[3] E GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
4m0w[6] G GOL
GLYCEROL[6 atoms]
A 100.0
/82.3
5
/5
R1A_CVHSA Replicase polyprotein 1a
5dus[3] G GOL
GLYCEROL[6 atoms]
A 0.0
/44.4
3
/3
T2B9G2_9BETC ORF1a
4ow0[1] F GOL
GLYCEROL[6 atoms]
A 66.7
/82.6
3
/3
R1A_CVHSA papain-like protease
4ypt[3] C GOL
GLYCEROL[6 atoms]
A 50.0
/31.2
8
/8
R1AB_CVMA5 Replicase polyprotein 1ab
6wrh[2] I GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
6
/6
R1AB_SARS2 Non-structural protein 3
5dus[1] F GOL
GLYCEROL[6 atoms]
A 25.0
/44.4
4
/4
T2B9G2_9BETC ORF1a
5wfi[1] G GOL
GLYCEROL[6 atoms]
A 0.0
/31.1
3
/3
R1AB_CVMA5 papain-like protease
6bi8[1] G GOL
GLYCEROL[6 atoms]
A 66.7
/31.5
3
/3
K4LC41_9BETC ORF1a
6xa9[3] K GOL
GLYCEROL[6 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 Papain-like protease
6bi8[1] M GOL
GLYCEROL[6 atoms]
B 75.0
/31.5
4
/4
K4LC41_9BETC ORF1a
6bi8[1] O GOL
GLYCEROL[6 atoms]
B 20.0
/31.5
5
/5
K4LC41_9BETC ORF1a
6z6i[1] H GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
10
/10
R1AB_SARS2 Replicase polyprotein 1ab
5y3e[1] J GOL
GLYCEROL[6 atoms]
A 100.0
/82.8
5
/5
R1A_CVHSA Replicase polyprotein 1a
2acf[1] N GOL
GLYCEROL[6 atoms]
C 50.0
/72.9
2
/2
Replicase polyprotein 1ab
5cb5[25] ZA SO4
SULFATE ION[5 atoms]
P 0.0
/34.0
1
/5
YMDB_ECOLI O-acetyl-ADP-ribose deacetylase
7kg3[4] G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
2w2g[2] D SO4
SULFATE ION[5 atoms]
B 33.3
/75.0
3
/3
R1A_CVHSA NON-STRUCTURAL PROTEIN 3
7jrn[2] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like proteinase
7kg3[2] H SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
4rf0[1] I SO4
SULFATE ION[5 atoms]
A 0.0
/31.4
4
/4
M4STU1_9BETC ORF1ab protein
2fe8[6] R SO4
SULFATE ION[5 atoms]
C 100.0
/82.7
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
4rf0[1] D SO4
SULFATE ION[5 atoms]
A 100.0
/31.4
2
/2
M4STU1_9BETC ORF1ab protein
4rf0[1] F SO4
SULFATE ION[5 atoms]
A 33.3
/31.4
6
/6
M4STU1_9BETC ORF1ab protein
4rf0[1] J SO4
SULFATE ION[5 atoms]
A 25.0
/31.4
4
/4
M4STU1_9BETC ORF1ab protein
4rf0[2] L SO4
SULFATE ION[5 atoms]
A 0.0
/31.4
2
/2
M4STU1_9BETC ORF1ab protein
5dus[1] E SO4
SULFATE ION[5 atoms]
A 66.7
/44.4
3
/3
T2B9G2_9BETC ORF1a
5dus[1] C SO4
SULFATE ION[5 atoms]
A 0.0
/44.4
1
/1
T2B9G2_9BETC ORF1a
7jrn[1] E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like proteinase
4rf0[1] H SO4
SULFATE ION[5 atoms]
A 0.0
/31.4
5
/5
M4STU1_9BETC ORF1ab protein
4rf0[1] E SO4
SULFATE ION[5 atoms]
A 25.0
/31.4
4
/4
M4STU1_9BETC ORF1ab protein
3ew5[2] L SO4
SULFATE ION[5 atoms]
C 0.0
/33.1
2
/2
R1AB_FIPV macro domain of Non-structural protein 3
6vxs[2] E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
6vxs[2] C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Non-structural protein 3
5dus[2] D SO4
SULFATE ION[5 atoms]
A 0.0
/44.4
2
/2
T2B9G2_9BETC ORF1a
3ew5[2] O SO4
SULFATE ION[5 atoms]
C 0.0
/33.1
1
/1
R1AB_FIPV macro domain of Non-structural protein 3
7jrn[1] J SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
5
/5
R1A_SARS2 Papain-like proteinase
3ew5[1] E SO4
SULFATE ION[5 atoms]
A 0.0
/33.1
3
/3
R1AB_FIPV macro domain of Non-structural protein 3
5tl6[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/82.9
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
3eke[1] B TLA
L(+)-TARTARIC ACID[10 atoms]
A 0.0
/31.9
4
/4
R1AB_IBVB Non-structural protein 3
3eke[1] C TLA
L(+)-TARTARIC ACID[10 atoms]
A 66.7
/31.9
6
/6
R1AB_IBVB Non-structural protein 3
4rf0[2] K 3CN
3-AMINOPROPANE[4 atoms]
A 80.0
/31.4
5
/5
M4STU1_9BETC ORF1ab protein
5v69[1] F PGO
S-1,2-PROPANEDIOL[5 atoms]
A 33.3
/31.4
3
/3
K0BWD0_9BETC MERS-CoV PLpro
4rez[2] D PGO
S-1,2-PROPANEDIOL[5 atoms]
A 28.6
/31.9
7
/7
M4STU1_9BETC ORF1ab protein
5v69[1] G PGO
S-1,2-PROPANEDIOL[5 atoms]
A 75.0
/31.4
8
/8
K0BWD0_9BETC MERS-CoV PLpro
4rez[1] C PGO
S-1,2-PROPANEDIOL[5 atoms]
A 20.0
/31.9
5
/5
M4STU1_9BETC ORF1ab protein
4rf1[1] E PGO
S-1,2-PROPANEDIOL[5 atoms]
A 50.0
/31.6
6
/6
M4STU1_9BETC ORF1ab protein
4rf1[3] F PGO
S-1,2-PROPANEDIOL[5 atoms]
A 25.0
/31.6
4
/4
M4STU1_9BETC ORF1ab protein
4rf1[1] H PGO
S-1,2-PROPANEDIOL[5 atoms]
A 0.0
/31.6
2
/2
M4STU1_9BETC ORF1ab protein
6bi8[2] T PGE
TRIETHYLENE GLYCOL[10 atoms]
A 0.0
/31.5
4
/4
K4LC41_9BETC ORF1a
6bi8[1] K PGE
TRIETHYLENE GLYCOL[10 atoms]
B 33.3
/31.5
3
/3
K4LC41_9BETC ORF1a
6bi8[1] E PGE
TRIETHYLENE GLYCOL[10 atoms]
A 60.0
/31.5
5
/5
K4LC41_9BETC ORF1a
6bi8[1] P CIT
CITRIC ACID[13 atoms]
B 50.0
/31.5
2
/2
K4LC41_9BETC ORF1a
5w8t[3] Q MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
D 50.0
/31.4
4
/4
K0BWD0_9BETC ORF1ab
5w8u[4] J MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 0.0
/31.4
3
/3
K0BWD0_9BETC ORF1ab
5w8t[4] L MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
B 50.0
/31.4
4
/4
K0BWD0_9BETC ORF1ab
5w8u[2] K MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 0.0
/31.4
3
/4
K0BWD0_9BETC ORF1ab
5w8t[1] O MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
D 33.3
/31.4
3
/3
K0BWD0_9BETC ORF1ab
5w8u[4] H AYE
prop-2-en-1-amine[4 atoms]
A 66.7
/31.4
6
/6
K0BWD0_9BETC ORF1ab
6bi8[2] S AYE
prop-2-en-1-amine[4 atoms]
B 66.7
/31.5
6
/6
K4LC41_9BETC ORF1a
5v6a[1] E FLC
CITRATE ANION[13 atoms]
A 0.0
/31.4
1
/1
K0BWD0_9BETC MERS-CoV PLpro
5v6a[1] D FLC
CITRATE ANION[13 atoms]
A 25.0
/31.4
4
/5
K0BWD0_9BETC MERS-CoV PLpro
7d6h[1] C PO4
PHOSPHATE ION[5 atoms]
A 83.3
/99.7
6
/6
R1A_SARS2 Papain-like protease
4rna[2] D PO4
PHOSPHATE ION[5 atoms]
A 16.7
/31.3
6
/6
K4LC41_9BETC papain-like protease
4rna[4] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/31.3
1
/1
K4LC41_9BETC papain-like protease
4rna[2] F PO4
PHOSPHATE ION[5 atoms]
A 50.0
/31.3
2
/2
K4LC41_9BETC papain-like protease
6xg3[3] C PO4
PHOSPHATE ION[5 atoms]
A 83.3
/99.7
6
/6
R1AB_SARS2 Peptidase C16
6wrh[2] E PO4
PHOSPHATE ION[5 atoms]
A 100.0
/99.7
5
/5
R1AB_SARS2 Non-structural protein 3
6wrh[2] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
4rna[2] E PO4
PHOSPHATE ION[5 atoms]
A 28.6
/31.3
7
/7
K4LC41_9BETC papain-like protease
4rna[2] C PO4
PHOSPHATE ION[5 atoms]
A 14.3
/31.3
7
/7
K4LC41_9BETC papain-like protease
5wfi[1] M FMT
FORMIC ACID[3 atoms]
B 0.0
/31.1
1
/1
R1AB_CVMA5 papain-like protease
5wfi[1] H FMT
FORMIC ACID[3 atoms]
A 25.0
/31.1
4
/4
R1AB_CVMA5 papain-like protease
4wur[1] C IPA
ISOPROPYL ALCOHOL[4 atoms]
A 16.7
/31.1
6
/6
R1AB_CVEMC Papain-like protease
4wur[1] D IPA
ISOPROPYL ALCOHOL[4 atoms]
A 33.3
/31.1
3
/3
R1AB_CVEMC Papain-like protease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.