#WARNING:no index is registered index "YP_009725298.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725298.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
888674 638 8 YP_009725298.1()
QUERYSEQ 
AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETS
WQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF
SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDW
LEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG
TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725298.1()]

638
region name description
28-33 DISORDER predicted by DISOPRED

MONOMER
638
pdb_id a1 identity[%]2 description
7msw A 100.0 R1AB_SARS2 Non-structural protein 2 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
METAL
638 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7exm[4] E ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1A_SARS2 Non-structural protein 2
7exm[4] F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1A_SARS2 Non-structural protein 2
7exm[4] G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1A_SARS2 Non-structural protein 2
7fa1[3] B ZN
ZINC ION[1 atoms] 		A 100.0
/76.4		 4
/4		 R1A_SARS Non-structural protein 2
7fa1[1] C ZN
ZINC ION[1 atoms] 		A 100.0
/76.4		 4
/4		 R1A_SARS Non-structural protein 2
7fa1[1] D ZN
ZINC ION[1 atoms] 		A 100.0
/76.4		 4
/4		 R1A_SARS Non-structural protein 2
7fac[1] B ZN
ZINC ION[1 atoms] 		A 100.0
/65.3		 4
/4		 R1A_SARS Non-structural protein 2
7fac[1] C ZN
ZINC ION[1 atoms] 		A 100.0
/65.3		 7
/7		 R1A_SARS Non-structural protein 2
7msw[2] C ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 2
7msw[2] D ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
638 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7exm[1] N GOL
GLYCEROL[6 atoms] 		C 100.0
/100.0		 5
/5		 R1A_SARS2 Non-structural protein 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.