#WARNING:no index is registered index "YP_009724397.2" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724397.2.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1668648 419 277 YP_009724397.2()
QUERYSEQ 
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRN
PANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH
WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009724397.2()]

419
region name description
1-419 DISORDER predicted by DISOPRED

MONOMER
419
pdb_id a1 identity[%]2 description
8fd5 A 100.0 NCAP_SARS2 Nucleoprotein 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7n0i[8] H Single-domain antibody E2[136 aa] A 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
7n3c[1] A S24-202 Fab heavy chain[226 aa] C 100.0
/100.0		 11
/11		 NCAP_SARS2 Nucleoprotein
7n3c[2] B S24-202 Fab light chain[214 aa] C 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7n3d[1] A S24-1564 Fab heavy chain[223 aa] C 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
7n3d[1] B S24-1564 Fab light chain[213 aa] C 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7pku[2] A A0A6M4N019_SARS2 3C-like proteinase[96 aa] B 100.0
/100.0		 18
/18		 A0A6G9KDV1_SARS2 Nucleoprotein
7wzo[1] C R1A_SARS2 nsp3[110 aa] A 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
7r98[3] D Nanobody B6[129 aa] A 100.0
/100.0		 14
/14		 NCAP_SARS2 Nucleoprotein
7str[1] B Fab S24-1063, Heavy chain[222 aa] C 100.0
/100.0		 11
/11		 NCAP_SARS2 Nucleoprotein
7ylb[8] C NC2[84 aa] A 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
7yld[3] E NN2[84 aa] A 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
7yld[1] H NN2[71 aa] C 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7acs[1] B RNA (5'-R(P*CP*AP*CP*UP*GP*AP*C)-3') A 100.0
/99.3		 5
/5		 NCAP_SARS2 Nucleoprotein
7xwz[1] C RNA (5'-R(*CP*AP*CP*UP*GP*AP*C)-3') A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7acs[1] C RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') A 100.0
/99.3		 11
/11		 NCAP_SARS2 Nucleoprotein
7xwz[2] D RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
7act[1] B ssRNA A 100.0
/100.0		 28
/28		 NCAP_SARS2 Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6kl6[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. 		B 83.3
/61.2		 6
/6		 A0A0D3MU65_9BETC Nucleoprotein
6kl6[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. 		D 57.1
/62.2		 7
/7		 A0A0D3MU65_9BETC Nucleoprotein
8iv3[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
8iv3[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8iv3[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. 		D 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7o35[3] E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		C 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7o35[3] E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		D 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz[1] G GKP
(2R,3R)-2,3-bis{[(2E)-3-(3,4-dihydroxyphenyl)prop-.. 		A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8j6x[1] E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
8j6x[1] E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. 		B 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
8j6x[1] E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. 		D 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
6kl5[1] E DJO
(phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi.. 		A 75.0
/60.5		 4
/4		 A0A0D3MU65_9BETC Nucleoprotein
6kl5[1] E DJO
(phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi.. 		C 50.0
/62.1		 4
/4		 A0A0D3MU65_9BETC Nucleoprotein
7dyd[1] E EY3
5-propan-2-yloxy-1H-indole[13 atoms] 		B 100.0
/59.8		 1
/1		 A0A2I2MQD0_9BETC Nucleoprotein
7dyd[1] E EY3
5-propan-2-yloxy-1H-indole[13 atoms] 		D 83.3
/61.8		 6
/6		 A0A2I2MQD0_9BETC Nucleoprotein
6lz8[1] E EY9
5-(2-methoxyethoxy)-1H-indole[14 atoms] 		C 50.0
/59.8		 2
/2		 A0A2I2MQD0_9BETC Nucleoprotein
6lz8[1] E EY9
5-(2-methoxyethoxy)-1H-indole[14 atoms] 		D 100.0
/61.6		 3
/3		 A0A2I2MQD0_9BETC Nucleoprotein
6lnn[1] E EJC
5-propoxy-1H-indole[13 atoms] 		B 100.0
/60.8		 1
/1		 A0A2I2MQD0_9BETC Nucleoprotein
6lnn[1] E EJC
5-propoxy-1H-indole[13 atoms] 		D 100.0
/61.3		 5
/5		 A0A2I2MQD0_9BETC Nucleoprotein
6lz6[1] E EY6
5-(2-fluoranylethoxy)-1H-indole[13 atoms] 		B 100.0
/59.8		 1
/1		 A0A2I2MQD0_9BETC Nucleoprotein
6lz6[1] E EY6
5-(2-fluoranylethoxy)-1H-indole[13 atoms] 		D 100.0
/60.9		 7
/7		 A0A2I2MQD0_9BETC Nucleoprotein
4li4[1] B AMP
ADENOSINE MONOPHOSPHATE[23 atoms] 		A 80.0
/50.0		 10
/14		 Q6SA23_CVHOC Nucleoprotein
4lm7[1] B U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] 		A 80.0
/50.0		 10
/14		 Q6SA23_CVHOC Nucleoprotein
4lmt[1] B CQD
6-chloro-7-{[2-(morpholin-4-yl)ethyl]amino}quinoli.. 		A 83.3
/49.6		 6
/10		 Q6SA23_CVHOC Nucleoprotein
4lm9[1] B 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] 		A 80.0
/49.6		 10
/14		 Q6SA23_CVHOC Nucleoprotein
4lmc[1] B C5P
CYTIDINE-5'-MONOPHOSPHATE[21 atoms] 		A 88.9
/49.6		 9
/13		 Q6SA23_CVHOC Nucleoprotein
4kxj[1] B P34
N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTH.. 		A 50.0
/49.2		 6
/10		 Q6SA23_CVHOC Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6g13[2] I CL
CHLORIDE ION[1 atoms] 		B 50.0
/55.1		 2
/2		 A0A0D3MU51_9BETC Nucleoprotein
6vyo[4] F CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo[4] I CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6wji[6] G CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji[4] H CL
CHLORIDE ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wji[3] K CL
CHLORIDE ION[1 atoms] 		D 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7n3d[1] O CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7n3d[1] P CL
CHLORIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxz[1] L CL
CHLORIDE ION[1 atoms] 		E 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo[12] H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo[8] J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xx1[4] J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7n0i[1] N MG
MAGNESIUM ION[1 atoms] 		D 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7n3c[1] T IOD
IODIDE ION[1 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7n3c[1] U IOD
IODIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7n3c[1] V IOD
IODIDE ION[1 atoms] 		C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7n3c[1] W IOD
IODIDE ION[1 atoms] 		C 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7n3c[1] X IOD
IODIDE ION[1 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxz[1] J NA
SODIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
4ud1[3] F NH4
AMMONIUM ION[1 atoms] 		A 0.0
/59.1		 2
/2		 T2B9R0_9BETC N PROTEIN
4ud1[1] J NH4
AMMONIUM ION[1 atoms] 		C 100.0
/59.1		 1
/1		 T2B9R0_9BETC N PROTEIN
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2cjr[108] B NCAP_CVHSA NUCLEOCAPSID PROTEIN[113 aa] A 98.1
/95.7		 52
/52		 NCAP_CVHSA NUCLEOCAPSID PROTEIN
2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/95.9		 8
/8		 NCAP_CVHSA Nucleocapsid protein
2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/95.9		 6
/6		 NCAP_CVHSA Nucleocapsid protein
2gib[2] B NCAP_CVHSA Nucleocapsid protein[96 aa] A 100.0
/95.9		 1
/1		 NCAP_CVHSA Nucleocapsid protein
2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] B 100.0
/95.8		 3
/3		 NCAP_CVHSA Nucleocapsid protein
6vyo[122] B NCAP_SARS2 Nucleoprotein[125 aa] A 100.0
/100.0		 12
/12		 NCAP_SARS2 Nucleoprotein
6vyo[12] D NCAP_SARS2 Nucleoprotein[125 aa] A 100.0
/100.0		 9
/9		 NCAP_SARS2 Nucleoprotein
7xx1[4] D NCAP_SARS2 Nucleoprotein[119 aa] A 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8iv3[2] B NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8iv3[2] C NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
8iv3[2] D NCAP_SARS2 Nucleoprotein[126 aa] A 100.0
/100.0		 11
/11		 NCAP_SARS2 Nucleoprotein
8iv3[4] A NCAP_SARS2 Nucleoprotein[126 aa] B 100.0
/100.0		 10
/10		 NCAP_SARS2 Nucleoprotein
8iv3[2] C NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
8iv3[2] D NCAP_SARS2 Nucleoprotein[126 aa] B 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
8iv3[4] A NCAP_SARS2 Nucleoprotein[126 aa] C 100.0
/100.0		 8
/8		 NCAP_SARS2 Nucleoprotein
8x1h[48] A NCAP_SARS2 Nucleoprotein[128 aa] A 100.0
/100.0		 128
/128		 NCAP_SARS2 Nucleoprotein
8x1h[16] A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/100.0		 13
/13		 NCAP_SARS2 Nucleoprotein
8x1h[16] D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
8x1h[16] C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7f2e[1] F NCAP_SARS2 Nucleoprotein[97 aa] E 100.0
/100.0		 43
/43		 NCAP_SARS2 Nucleoprotein
7f2e[1] L NCAP_SARS2 Nucleoprotein[92 aa] K 100.0
/100.0		 41
/41		 NCAP_SARS2 Nucleoprotein
6kl2[12] C A0A0D3MU65_9BETC Nucleoprotein[104 aa] A 57.1
/61.4		 7
/9		 A0A0D3MU65_9BETC Nucleoprotein
6lnn[16] C A0A2I2MQD0_9BETC Nucleoprotein[114 aa] A 66.7
/59.5		 9
/12		 A0A2I2MQD0_9BETC Nucleoprotein
6g13[4] C A0A0D3MU51_9BETC Nucleoprotein[113 aa] A 63.0
/55.2		 54
/55		 A0A0D3MU51_9BETC Nucleoprotein
5n4k[2] B NCAP_CVHNL Nucleoprotein[129 aa] A 41.7
/46.0		 12
/22		 NCAP_CVHNL Nucleoprotein
2gec[1] B NCAP_IBVG Nucleocapsid protein[139 aa] A 27.8
/40.7		 18
/18		 NCAP_IBVG Nucleocapsid protein
2gec[1] A NCAP_IBVG Nucleocapsid protein[138 aa] B 35.0
/40.7		 20
/25		 NCAP_IBVG Nucleocapsid protein
5epw[2] B NCAP_CVHNL Nucleoprotein[110 aa] A 31.4
/38.0		 51
/54		 NCAP_CVHNL Nucleoprotein
8ym1[8] F nucleocapsid phosphoprotein[103 aa] A 31.4
/34.1		 51
/52		 nucleocapsid phosphoprotein
8wqk[8] D NCAP_PEDV7 Nucleoprotein[100 aa] A 26.8
/32.0		 56
/56		 NCAP_PEDV7 Nucleoprotein
2ge7[10] B NCAP_IBVG Nucleocapsid protein[108 aa] A 35.1
/29.1		 57
/59		 NCAP_IBVG Nucleocapsid protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2gib[5] C SO4
SULFATE ION[5 atoms] 		A 100.0
/95.9		 2
/2		 NCAP_CVHSA Nucleocapsid protein
5n4k[4] D SO4
SULFATE ION[5 atoms] 		A 66.7
/46.0		 3
/3		 NCAP_CVHNL Nucleoprotein
5n4k[1] I SO4
SULFATE ION[5 atoms] 		A 50.0
/46.0		 2
/2		 NCAP_CVHNL Nucleoprotein
5n4k[7] J SO4
SULFATE ION[5 atoms] 		A 50.0
/46.0		 2
/4		 NCAP_CVHNL Nucleoprotein
5n4k[2] K SO4
SULFATE ION[5 atoms] 		A 0.0
/46.0		 2
/2		 NCAP_CVHNL Nucleoprotein
6wzq[1] F SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wzq[3] G SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6wzq[1] I SO4
SULFATE ION[5 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
2ofz[1] B EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/92.1		 2
/2		 NCAP_CVHSA Nucleocapsid protein
7n3c[1] M EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7n3c[1] R EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7n3c[1] S EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7n3d[1] K EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7n3d[2] L EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7n3d[1] M EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7n3d[1] N EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7str[1] D EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7str[1] G EDO
1,2-ETHANEDIOL[4 atoms] 		C 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7xwz[2] G EDO
1,2-ETHANEDIOL[4 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
4ud1[2] I GOL
GLYCEROL[6 atoms] 		B 66.7
/59.1		 3
/3		 T2B9R0_9BETC N PROTEIN
4ud1[5] M GOL
GLYCEROL[6 atoms] 		D 0.0
/60.7		 3
/3		 T2B9R0_9BETC N PROTEIN
6vyo[3] K GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
6vyo[2] P GOL
GLYCEROL[6 atoms] 		C 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
7o36[1] F GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 9
/9		 NCAP_SARS2 Nucleoprotein
7uxx[1] G GOL
GLYCEROL[6 atoms] 		A 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxx[17] G GOL
GLYCEROL[6 atoms] 		C 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxx[3] J GOL
GLYCEROL[6 atoms] 		F 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xwz[1] I GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 6
/6		 NCAP_SARS2 Nucleoprotein
6g13[1] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 80.0
/55.2		 5
/5		 A0A0D3MU51_9BETC Nucleoprotein
7c22[1] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7de1[1] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7de1[2] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxz[2] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7uxz[1] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
6vyo[6] E MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
6vyo[6] G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7xx1[4] G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/100.0		 4
/4		 NCAP_SARS2 Nucleoprotein
7xx1[4] L MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7c22[2] E ACT
ACETATE ION[4 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7c22[2] E ACT
ACETATE ION[4 atoms] 		B 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7n0i[1] M ACT
ACETATE ION[4 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7n0i[1] M ACT
ACETATE ION[4 atoms] 		D 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7n0i[1] O ACT
ACETATE ION[4 atoms] 		L 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7uxx[1] I ACT
ACETATE ION[4 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7uxx[1] I ACT
ACETATE ION[4 atoms] 		D 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7vnu[1] E ACT
ACETATE ION[4 atoms] 		C 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2b[2] C PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7f2b[3] D PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
7f2b[1] F PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 5
/5		 NCAP_SARS2 Nucleoprotein
7f2b[1] H PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2e[4] M PO4
PHOSPHATE ION[5 atoms] 		G 100.0
/100.0		 3
/3		 NCAP_SARS2 Nucleoprotein
7f2e[4] M PO4
PHOSPHATE ION[5 atoms] 		H 100.0
/100.0		 1
/1		 NCAP_SARS2 Nucleoprotein
7xwx[3] I PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 NCAP_SARS2 Nucleoprotein
4ud1[2] H IMD
IMIDAZOLE[5 atoms] 		B 100.0
/59.1		 3
/3		 T2B9R0_9BETC N PROTEIN
6g13[1] E TMO
trimethylamine oxide[5 atoms] 		A 0.0
/55.2		 1
/1		 A0A0D3MU51_9BETC Nucleoprotein
6g13[3] F TMO
trimethylamine oxide[5 atoms] 		A 66.7
/55.2		 3
/3		 A0A0D3MU51_9BETC Nucleoprotein
4j3k[1] B TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] 		A 44.4
/50.0		 9
/9		 Q6SA23_CVHOC Nucleoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.