#WARNING:no index is registered index "YP_009724396.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724396.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1223610 121 9 YP_009724396.1()
QUERYSEQ
MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009724396.1()]

121
region name description
1-9 DISORDER predicted by DISOPRED

MONOMER
121
pdb_id a1 identity[%]2 description
7jx6 A 100.0 NS8_SARS2 ORF8 protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
121 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7xmn[2] A A0A376KDN7_ECOLX Maltodextrin-binding protein[367 aa] B 100.0
/100.0
9
/9
NS8_SARS2 ORF8 protein
7xmn[2] A A0A376KDN7_ECOLX Maltodextrin-binding protein[367 aa] B 100.0
/100.0
17
/17
NS8_SARS2 ORF8 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
121 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7xmn[2] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/100.0
4
/4
NS8_SARS2 ORF8 protein
7xmn[2] I NNH
NOR-N-OMEGA-HYDROXY-L-ARGININE[12 atoms]
B 100.0
/100.0
4
/4
NS8_SARS2 ORF8 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
121 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7jtl[1] C NA
SODIUM ION[1 atoms]
A 100.0
/100.0
2
/2
NS8_SARS2 ORF8 protein
7jx6[2] C NA
SODIUM ION[1 atoms]
A 100.0
/100.0
4
/4
NS8_SARS2 ORF8 protein
7jx6[2] C NA
SODIUM ION[1 atoms]
A 100.0
/100.0
1
/1
NS8_SARS2 ORF8 protein
7jx6[2] D NA
SODIUM ION[1 atoms]
A 100.0
/100.0
2
/2
NS8_SARS2 ORF8 protein
7jx6[2] E NA
SODIUM ION[1 atoms]
A 100.0
/100.0
2
/2
NS8_SARS2 ORF8 protein
7jx6[2] F NA
SODIUM ION[1 atoms]
B 100.0
/100.0
4
/4
NS8_SARS2 ORF8 protein
7f5f[1] B CA
CALCIUM ION[1 atoms]
A 100.0
/99.0
2
/2
A0A6B9VKN0_SARS2 ORF8 protein
7f8l[4] C CA
CALCIUM ION[1 atoms]
A 100.0
/97.1
2
/2
A0A6B9WE90_SARS Nonstructural protein NS8
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
121 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7f8l[10] B A0A6B9WE90_SARS Nonstructural protein NS8[104 aa] A 100.0
/97.1
15
/15
A0A6B9WE90_SARS Nonstructural protein NS8
7xmn[2] B NS8_SARS2 ORF8 protein[102 aa] B 100.0
/100.0
4
/4
NS8_SARS2 ORF8 protein
7jx6[2] B NS8_SARS2 ORF8 protein[88 aa] A 100.0
/100.0
17
/17
NS8_SARS2 ORF8 protein
7jx6[2] B NS8_SARS2 ORF8 protein[88 aa] A 100.0
/100.0
4
/4
NS8_SARS2 ORF8 protein
7mx9[2] A NS8_SARS2 ORF8 protein[88 aa] A 100.0
/98.9
13
/13
NS8_SARS2 ORF8 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
121 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7xmn[2] E SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
3
/3
NS8_SARS2 ORF8 protein
7xmn[2] J SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
2
/2
NS8_SARS2 ORF8 protein
7xmn[2] K SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
5
/5
NS8_SARS2 ORF8 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.