![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
22861 | 121 | 4 | YP_009724396.1() | |
QUERYSEQ |
MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
121 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() |
1-9 | DISORDER | predicted by DISOPRED (1-9) |
![]() |
|||||||
121 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | NS8_SARS2 ORF8 protein | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
121 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() |
![]() |
E |
NA
|
A | 100.0 /100.0 |
2 /2 |
NS8_SARS2 ORF8 protein |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
NA
|
A | 100.0 /100.0 |
2 /2 |
NS8_SARS2 ORF8 protein |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
NA
|
A | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
NA
|
A | 100.0 /100.0 |
2 /2 |
NS8_SARS2 ORF8 protein |
![]() ![]() ![]() ![]() ![]() |
![]() |
F |
NA
|
B | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein |
![]() ![]() ![]() ![]() |
![]() |
C |
NA
|
A | 100.0 /100.0 |
1 /1 |
NS8_SARS2 ORF8 protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
121 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS8_SARS2 ORF8 protein[101 aa] | A | 100.0 /100.0 |
15 /15 |
NS8_SARS2 ORF8 protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS8_SARS2 ORF8 protein[88 aa] | A | 100.0 /100.0 |
4 /4 |
NS8_SARS2 ORF8 protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS8_SARS2 ORF8 protein[88 aa] | A | 100.0 /100.0 |
17 /17 |
NS8_SARS2 ORF8 protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |