Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
3984123 | 222 | 12 | YP_009724393.1() | |
QUERYSEQ |
MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLR IAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ |
222 | region | name | description |
1-219 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
222 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7vgr | E | 100.0 | VME1_SARS2 Membrane protein | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
222 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7vgr[2] | A | YN7756_1 Fab light chain[218 aa] | E | 100.0 /100.0 |
3 /3 |
VME1_SARS2 Membrane protein | |
7vgr[2] | C | YN7756_1 Fab light chain[218 aa] | E | 100.0 /100.0 |
4 /4 |
VME1_SARS2 Membrane protein | |
7vgr[2] | B | YN7756_1 Fab heavy chain[220 aa] | E | 100.0 /100.0 |
9 /9 |
VME1_SARS2 Membrane protein | |
7vgr[2] | D | YN7756_1 Fab heavy chain[220 aa] | E | 100.0 /100.0 |
4 /4 |
VME1_SARS2 Membrane protein | |
7vgs[2] | B | YN7717_9 Fab light chain[218 aa] | A | 100.0 /100.0 |
9 /9 |
VME1_SARS2 Membrane protein | |
7vgs[2] | E | YN7717_9 Fab light chain[218 aa] | A | 100.0 /100.0 |
3 /3 |
VME1_SARS2 Membrane protein | |
7vgs[2] | C | YN7717_9 Fab heavy chain[213 aa] | A | 100.0 /100.0 |
9 /9 |
VME1_SARS2 Membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
222 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7y9b[4] | E |
N8E
3,6,9,12,15-PENTAOXATRICOSAN-1-OL[24 atoms] |
A | 25.0 /46.2 |
4 /4 |
VME1_BCHK5 Membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
222 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7vgr[4] | F | VME1_SARS2 Membrane protein[198 aa] | E | 100.0 /100.0 |
46 /46 |
VME1_SARS2 Membrane protein | |
8ctk[2] | B | VME1_SARS2 Membrane protein[188 aa] | A | 100.0 /100.0 |
36 /36 |
VME1_SARS2 Membrane protein | |
7y9b[4] | B | VME1_BCHK5 Membrane protein[187 aa] | A | 45.6 /46.2 |
57 /58 |
VME1_BCHK5 Membrane protein | |
7y96[4] | B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | A | 53.3 /44.0 |
30 /38 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y96[4] | B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | A | 18.2 /44.0 |
11 /11 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
7y96[2] | B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | B | 43.9 /44.2 |
41 /41 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |