#WARNING:no index is registered index 'YP_009724391.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
21131 275 4 YP_009724391.1()
QUERYSEQ
MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWH
TNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009724391.1()]

275
region name description
1-275 DISORDER predicted by DISOPRED (1-6,8-8,10-15,267-275)

MONOMER
275
pdb_id a1 identity[%]2 description
6xdc B 100.0 AP3A_SARS2 ORF3a protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
275 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7kjr[2] C APOA1_HUMAN Apolipoprotein A-I[31 aa] A 100.0
/100.0
6
/6
AP3A_SARS2 ORF3a protein
7kjr[2] D APOA1_HUMAN Apolipoprotein A-I[31 aa] A 100.0
/100.0
6
/6
AP3A_SARS2 ORF3a protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
275 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7kjr[2] E PEE
1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine[23 a..
A 100.0
/100.0
4
/4
AP3A_SARS2 ORF3a protein
7kjr[2] E PEE
1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine[23 a..
B 100.0
/100.0
4
/4
AP3A_SARS2 ORF3a protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
275 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7kjr[4] A AP3A_SARS2 ORF3a protein[193 aa] B 100.0
/100.0
55
/55
AP3A_SARS2 ORF3a protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.