#WARNING:no index is registered index 'YP_009724390.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
18052 1273 500 YP_009724390.1()
QUERYSEQ
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNK
SWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN
YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP
GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECS
NLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLM
SFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009724390.1()]

1273
region name description
1-1273 DISORDER predicted by DISOPRED (1-26,679-687,1021-1021,1024-1024,1271-1273)

MONOMER
1273
pdb_id a1 identity[%]2 description
7jjj D 99.8 SPIKE_SARS2 Spike glycoprotein
7krq B 99.9 SPIKE_SARS2 Spike glycoprotein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7cws[3] J Light Chain of FC05 Fab[109 aa] M 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
7cwu[3] B light chain of FC05 Fab[109 aa] H 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
7cwn[12] L heavy chain of P17 Fab[120 aa] A 100.0
/100.0
11
/11
SPIKE_SARS2 Spike glycoprotein
7cwu[3] C heavy chain of FC05 Fab[120 aa] G 100.0
/100.0
10
/10
SPIKE_SARS2 Spike glycoprotein
7cws[3] I Heavy Chain of FC05 Fab[120 aa] M 100.0
/100.0
10
/10
SPIKE_SARS2 Spike glycoprotein
7cak[6] F Light chain of H014 Fab[107 aa] B 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7cws[3] G Light Chain of H014 Fab[107 aa] M 100.0
/100.0
8
/8
SPIKE_SARS2 Spike glycoprotein
7lqv[3] H 4-8 Heavy Chain[125 aa] C 100.0
/99.8
15
/15
SPIKE_SARS2 Spike glycoprotein
7ls9[3] B 1-57 Fab heavy chain[129 aa] A 100.0
/99.8
14
/14
SPIKE_SARS2 Spike glycoprotein
7lqv[3] G 4-8 Light chain[104 aa] B 100.0
/99.8
8
/8
SPIKE_SARS2 Spike glycoprotein
7ksg[3] F Nanobody against SARS-CoV-2 glycoprotein[129 aa] C 100.0
/99.8
16
/16
SPIKE_SARS2 Spike glycoprotein
7dcx[9] D The heavy chain of 3C1 fab that binds with the up .. H 100.0
/99.8
22
/22
SPIKE_SARS2 Spike glycoprotein
7dcx[1] B The heavy chain of 3C1 fab that binds with the up .. I 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7dcx[2] G The light chain of 3C1 fab[213 aa] C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dcc[9] E The light chain of 3C1 fab[213 aa] H 100.0
/99.8
19
/19
SPIKE_SARS2 Spike glycoprotein
7dcx[1] F The light chain of 3C1 fab[180 aa] I 100.0
/99.8
17
/17
SPIKE_SARS2 Spike glycoprotein
7dd2[1] D The light chain of 3C1 fab[213 aa] B 100.0
/99.8
7
/7
SPIKE_SARS2 Spike glycoprotein
7dk7[8] F The light chain fragment of 2H2 Fab[218 aa] C 100.0
/99.8
13
/13
SPIKE_SARS2 Spike glycoprotein
7dk4[1] I The light chain of 2H2 Fab[218 aa] D 100.0
/99.8
10
/10
SPIKE_SARS2 Spike glycoprotein
7dk7[1] A The heavy chain fragment of 2H2 Fab[18 aa] I 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk7[1] B The light chain fragment of 2H2 Fab[119 aa] I 100.0
/99.8
8
/8
SPIKE_SARS2 Spike glycoprotein
7dk7[8] G The heavy chain fragment of 2H2 Fab[214 aa] D 100.0
/99.8
14
/14
SPIKE_SARS2 Spike glycoprotein
7a29[6] D Neutralising sybody (Sb23)[114 aa] A 100.0
/99.8
9
/9
SPIKE_SARS2 Spike glycoprotein
7a29[1] F Neutralising sybody (Sb23)[114 aa] A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7c2l[3] H heavy chain of 4A8[229 aa] C 100.0
/99.8
11
/11
SPIKE_SARS2 Spike glycoprotein
6zxn[3] E Nanobody Ty1[118 aa] B 100.0
/99.8
18
/18
SPIKE_SARS2 Spike glycoprotein
6zxn[1] F Nanobody Ty1[118 aa] A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6xey[3] G 2-4 Heavy Chain[122 aa] C 100.0
/99.8
13
/13
SPIKE_SARS2 Spike glycoprotein
7k43[3] B S2M11 Fab fragment (heavy chain)[122 aa] A 100.0
/99.8
14
/14
SPIKE_SARS2 Spike glycoprotein
7k43[3] B S2M11 Fab fragment (heavy chain)[122 aa] D 100.0
/99.8
7
/7
SPIKE_SARS2 Spike glycoprotein
7k43[3] F S2M11 Fab fragment (light chain)[105 aa] D 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7k43[3] C S2M11 Fab fragment (light chain)[105 aa] D 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7ls9[3] I 1-57 Fab light chain[108 aa] G 100.0
/99.8
6
/6
SPIKE_SARS2 Spike glycoprotein
7dx9[25] E ACE2_HUMAN Angiotensin-converting enzyme 2[595 aa] C 100.0
/99.8
17
/17
SPIKE_SARS2 Spike glycoprotein
7a96[8] D ACE2_HUMAN Angiotensin-converting enzyme 2[588 aa] A 100.0
/99.8
16
/16
SPIKE_SARS2 Spike glycoprotein
7cwn[6] G heavy chain of H014 Fab[122 aa] B 100.0
/100.0
16
/16
SPIKE_SARS2 Spike glycoprotein
7cws[3] D Heavy Chain of H014 Fab[122 aa] N 100.0
/100.0
17
/17
SPIKE_SARS2 Spike glycoprotein
7cai[3] D Light chain of H014 Fab[207 aa] A 100.0
/99.8
7
/7
SPIKE_SARS2 Spike glycoprotein
7jw0[3] I S304 Fab heavy chain[219 aa] G 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7d0c[2] E Light chain of P5A-3A1[215 aa] A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7ljr[1] E Fab DH1043 light chain[206 aa] A 100.0
/99.8
10
/10
SPIKE_SARS2 Spike glycoprotein
7d0c[2] D Heavy chain of P5A-3A1[219 aa] A 100.0
/99.8
17
/17
SPIKE_SARS2 Spike glycoprotein
7d0d[3] E Heavy chain of P5A-3C12[125 aa] G 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7k8x[1] E C121 Fab Heavy chain[128 aa] B 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7k8y[3] D C121 Fab Heavy chain[128 aa] A 100.0
/99.8
11
/11
SPIKE_SARS2 Spike glycoprotein
7k8y[2] E C121 Fab Light chain[108 aa] B 100.0
/99.8
6
/6
SPIKE_SARS2 Spike glycoprotein
7k8x[2] G C121 Fab Light chain[108 aa] A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7ljr[1] D Fab DH1043 heavy chain[226 aa] A 100.0
/99.8
17
/17
SPIKE_SARS2 Spike glycoprotein
6zdh[3] D EY6A heavy chain[219 aa] C 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6zdh[3] H EY6A heavy chain[219 aa] C 100.0
/99.8
11
/11
SPIKE_SARS2 Spike glycoprotein
7k8t[2] H C002 Fab Heavy Chain[125 aa] C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7k8s[6] D C002 Fab Heavy Chain[125 aa] A 100.0
/99.8
13
/13
SPIKE_SARS2 Spike glycoprotein
7byr[1] D Ab23-Fab-Heavy Chain[102 aa] B 100.0
/99.8
14
/14
SPIKE_SARS2 Spike glycoprotein
7lcn[3] H DH1050.1 heavy chain[223 aa] G 100.0
/99.8
11
/11
SPIKE_SARS2 Spike glycoprotein
7lss[1] E Fab 2-7 variable heavy chain[119 aa] B 100.0
/99.8
9
/9
SPIKE_SARS2 Spike glycoprotein
7lss[1] D Fab 2-7 variable light chain[108 aa] B 100.0
/99.8
7
/7
SPIKE_SARS2 Spike glycoprotein
7jwb[2] A autonomous human heavy chain variable domain[366 a.. C 100.0
/99.8
30
/30
SPIKE_SARS2 Spike glycoprotein
6zhd[6] E Nanobody H11-H4[128 aa] C 100.0
/99.8
14
/14
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6zhd[1] F Nanobody H11-H4[128 aa] A 100.0
/99.8
1
/1
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
7jvc[3] C S2A4 Fab light chain[214 aa] A 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7jvc[3] E S2A4 Fab heavy chain[220 aa] D 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7ks9[1] B 910-30 Fab heavy chain[112 aa] D 100.0
/99.8
17
/17
SPIKE_SARS2 Spike glycoprotein
7ks9[1] A 910-30 Fab light chain[107 aa] D 100.0
/99.8
14
/14
SPIKE_SARS2 Spike glycoprotein
7laa[1] C DH1041 heavy chain[217 aa] A 100.0
/99.7
14
/14
SPIKE_SARS2 Spike glycoprotein
7laa[1] D DH1041 light chain[217 aa] A 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7k8u[1] D C104 Fab Heavy Chain[106 aa] A 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7k8w[1] F C119 Fab Heavy Chain[126 aa] A 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7k8w[2] F C119 Fab Heavy Chain[126 aa] C 100.0
/99.7
8
/8
SPIKE_SARS2 Spike glycoprotein
7k8w[2] E C119 Fab Light Chain[111 aa] A 100.0
/99.7
5
/5
SPIKE_SARS2 Spike glycoprotein
7k8u[1] E C104 Fab Light Chain[107 aa] A 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7k8u[1] E C104 Fab Light Chain[107 aa] B 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6xey[3] I A0A5C2GJG2_HUMAN 2-4 Light Chain[108 aa] A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6xcn[5] G C105 Fab Light Chain[111 aa] A 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6xcm[5] E C105 Fab Heavy Chain[116 aa] B 100.0
/99.7
13
/13
SPIKE_SARS2 Spike glycoprotein
7cac[3] E Heavy chain of H014 Fab[214 aa] B 100.0
/99.5
19
/19
SPIKE_SARS2 Spike glycoprotein
7cai[2] G Heavy chain of H014 Fab[214 aa] C 100.0
/99.8
8
/8
SPIKE_SARS2 Spike glycoprotein
7kxj[11] I Fab 15033-7 heavy chain[223 aa] C 100.0
/99.4
10
/10
SPIKE_SARS2 Spike glycoprotein
7kxk[1] I Fab 15033-7 heavy chain[223 aa] B 100.0
/99.4
3
/3
SPIKE_SARS2 Spike glycoprotein
7kxj[11] F Fab 15033-7 light chain[214 aa] B 100.0
/99.4
15
/15
SPIKE_SARS2 Spike glycoprotein
7kxk[1] H Fab 15033-7 light chain[214 aa] B 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
6zdh[3] I EY6A light chain[215 aa] C 100.0
/99.8
12
/12
SPIKE_SARS2 Spike glycoprotein
7jw0[3] B S304 Fab light chain[212 aa] A 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7kxk[1] H Fab 15033-7 light chain[214 aa] A 100.0
/99.4
2
/2
SPIKE_SARS2 Spike glycoprotein
7chh[3] G BD-368-2 Fab light chain[112 aa] B 100.0
/99.4
3
/3
SPIKE_SARS2 Spike glycoprotein
7cwn[18] M light chain of P17 Fab[107 aa] A 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
7cwl[3] G Fab P17 light chain[108 aa] B 100.0
/100.0
6
/6
SPIKE_SARS2 Spike glycoprotein
7k8s[3] E C002 Fab Light Chain[107 aa] C 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7l3n[1] E LY-CoV555 Fab light chain[106 aa] B 100.0
/99.4
6
/6
SPIKE_SARS2 Spike glycoprotein
7l3n[1] D LY-CoV555 Fab heavy chain[124 aa] C 100.0
/99.4
2
/2
SPIKE_SARS2 Spike glycoprotein
7l3n[1] D LY-CoV555 Fab heavy chain[124 aa] B 100.0
/99.4
14
/14
SPIKE_SARS2 Spike glycoprotein
7k90[3] G C144 Fab Light Chain[108 aa] B 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
7k90[3] E C144 Fab Heavy Chain[129 aa] A 100.0
/99.4
12
/12
SPIKE_SARS2 Spike glycoprotein
7k90[3] E C144 Fab Heavy Chain[129 aa] B 100.0
/99.4
7
/7
SPIKE_SARS2 Spike glycoprotein
7chh[3] F BD-368-2 Fab heavy chain[124 aa] B 100.0
/99.4
9
/9
SPIKE_SARS2 Spike glycoprotein
7k4n[3] F S2E12 neutralizing antibody Fab fragment (light ch.. D 100.0
/99.4
3
/3
SPIKE_SARS2 Spike glycoprotein
7k4n[3] B S2E12 neutralizing antibody Fab fragment (heavy ch.. A 100.0
/99.4
2
/2
SPIKE_SARS2 Spike glycoprotein
7kl9[3] E CTC-445.2 inhibitor[160 aa] C 100.0
/99.4
15
/15
SPIKE_SARS2 Spike glycoprotein
7kl9[1] D CTC-445.2 inhibitor[160 aa] C 100.0
/99.4
6
/6
SPIKE_SARS2 Spike glycoprotein
7jzn[1] F LCB3[64 aa] E 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7e7b[5] XA VCG
2-hydroxyethyl 2-deoxy-3,5-bis-O-(2-hydroxyethyl)-..
A 100.0
/100.0
11
/11
SPIKE_SARS2 CO1A1_HUMAN Spike glycoprotein,Collagen alpha-1(I) chain
7e7b[3] FB VCG
2-hydroxyethyl 2-deoxy-3,5-bis-O-(2-hydroxyethyl)-..
B 100.0
/100.0
3
/3
SPIKE_SARS2 CO1A1_HUMAN Spike glycoprotein,Collagen alpha-1(I) chain
7lwi[654] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7lqv[12] JA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7k8s[199] SA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zge[14] ZA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7knh[98] TA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7lwt[266] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.4
6
/6
SPIKE_SARS2 Spike glycoprotein
6zdh[22] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7jvc[1371] VA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
G 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
6zoy[229] SA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.6
5
/5
SPIKE_SARS2 Spike glycoprotein
7bno[16] U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7d0c[220] UA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7cac[102] MA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.5
1
/1
SPIKE_SARS2 Spike glycoprotein
7l3n[1] R NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
7bnn[13] RA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7lyp[45] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
6zox[18] GA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6zp0[12] PA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
7lwu[1] AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.4
2
/2
SPIKE_SARS2 Spike glycoprotein
7bnn[11] JA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
6x6p[4] FA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7jw0[12] CB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
G 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7lcn[3] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7bno[19] M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
6zoz[11] MA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.6
1
/1
SPIKE_SARS2 Spike glycoprotein
7jw0[8] FB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
G 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7bnm[85] NA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7lcn[3] SA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7k43[11] DB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
G 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7kms[9] PA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7jvc[45] BB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
G 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7lcn[2] RA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7cn4[3] EA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/97.3
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
7bbh[3] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/91.6
2
/2
A0A6M3G9R1_9BETC Surface glycoprotein
6zp0[18] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
7lwl[10] S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7a94[5] X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7lqv[12] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7cn9[5] DA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6zgf[9] GB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/97.4
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
7jvc[17] SA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7k8t[1] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7l3n[1] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
6zox[15] WA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6zoz[18] PA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.6
2
/2
SPIKE_SARS2 Spike glycoprotein
7lcn[3] Y NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7cn9[2] CA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
6z43[1] ZA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7l3n[2] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
7bbh[3] ZA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/91.6
3
/3
A0A6M3G9R1_9BETC Surface glycoprotein
7lqv[2] JA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7bbh[3] OA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/91.6
1
/1
A0A6M3G9R1_9BETC Surface glycoprotein
7cn9[6] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
6zoz[4] OA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.6
3
/3
SPIKE_SARS2 Spike glycoprotein
7cn8[3] RA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/92.0
1
/1
Glycoprotein
6x6p[3] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7cws[10] NA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
M 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
7lcn[2] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
G 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6zgf[3] VA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/97.4
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
7bbh[3] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/91.6
1
/1
A0A6M3G9R1_9BETC Surface glycoprotein
7lqv[1] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7k8t[1] VA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6xf5[1] EA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7lwv[1] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
7lqv[1] S NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7l3n[1] T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.4
4
/4
SPIKE_SARS2 Spike glycoprotein
6xlu[1] JA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xr8[3] MA alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. C 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6xr8[3] HA alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
7
/7
SPIKE_SARS2 Spike glycoprotein
6xr8[3] W alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6xr8[3] X alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. C 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6xr8[3] X alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6xr8[3] BA alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. C 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6xr8[3] V alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6xr8[3] LA alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. C 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6xr8[3] EA alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. C 100.0
/100.0
6
/6
SPIKE_SARS2 Spike glycoprotein
6xr8[3] M alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6xcn[5] X 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7jjj[2] GB 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. D 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zgf[3] R 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/97.4
2
/2
A0A6B9WHD3_CVHSA Spike glycoprotein
7jjj[2] GB 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. F 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7cn9[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
6xr8[3] DA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. C 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
7bnn[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7bnn[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7c2l[3] T 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7c2l[3] CA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7jjj[2] HC beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7jjj[2] TA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7k43[3] S beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. D 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6xey[2] Q beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6zp7[2] F alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zp7[2] E alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7cn9[1] O alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7cn9[1] L alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7cn9[1] L alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6x6p[3] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7dwx[51] CB 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. I 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7a25[43] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
7
/7
SPIKE_SARS2 Spike glycoprotein
7lwt[332] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
6xm4[3] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6zb4[146] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
7bnm[12] R 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
6zp1[86] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zgf[12] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/97.4
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
7d0c[46] BA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7ls9[58] Y 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/99.8
5
/5
SPIKE_SARS2 Spike glycoprotein
6x6p[184] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6z97[121] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
3
/3
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6xm3[30] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zgi[9] V 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7bbh[29] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/91.6
1
/1
A0A6M3G9R1_9BETC Surface glycoprotein
7jwy[8] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7bnn[13] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
7jvc[9] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zgi[9] O 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7cn8[70] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/92.0
3
/3
Glycoprotein
6zge[9] BA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zge[6] CA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7jjj[24] SB 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. F 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7jjj[30] FA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
5
/5
SPIKE_SARS2 Spike glycoprotein
7jjj[15] GA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
5
/5
SPIKE_SARS2 Spike glycoprotein
7jw0[6] X 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. G 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6xm4[2] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6z43[6] X 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7bbh[3] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/91.6
1
/1
A0A6M3G9R1_9BETC Surface glycoprotein
7lcn[4] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zgf[11] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/97.4
5
/5
A0A6B9WHD3_CVHSA Spike glycoprotein
6zge[17] EA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7jw0[9] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7cn8[3] W 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/92.0
1
/1
Glycoprotein
6zge[6] W 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7c2l[25] V 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6zgf[3] U 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/97.4
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
7lcn[3] S 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6xm3[10] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
5
/5
SPIKE_SARS2 Spike glycoprotein
7cn8[3] AA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/92.0
3
/3
Glycoprotein
6zgf[3] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/97.4
3
/3
A0A6B9WHD3_CVHSA Spike glycoprotein
7jjj[15] T 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7bnn[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7lwt[3] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.4
4
/4
SPIKE_SARS2 Spike glycoprotein
7lcn[1] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6zge[9] Z 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
5
/5
SPIKE_SARS2 Spike glycoprotein
7e7d[12] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
3
/3
SPIKE_SARS2 CO1A1_HUMAN Spike glycoprotein,Collagen alpha-1(I) chain
6xey[1] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7k43[3] Y 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. G 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7cn8[2] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/92.0
1
/1
Glycoprotein
7laa[1] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
6xey[3] S 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7laa[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
6zp7[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7cn9[1] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7lwt[1] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.4
3
/3
SPIKE_SARS2 Spike glycoprotein
7l3n[1] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.4
4
/4
SPIKE_SARS2 Spike glycoprotein
7c2l[3] V 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7bbh[3] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/91.6
1
/1
A0A6M3G9R1_9BETC Surface glycoprotein
7cn8[1] BA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/92.0
1
/1
Glycoprotein
7lcn[3] T 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. G 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7laa[1] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7kxj[7] J beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.4
4
/4
SPIKE_SARS2 Spike glycoprotein
7byr[1] K beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6xcn[5] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
6zgf[3] I beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/97.4
3
/3
A0A6B9WHD3_CVHSA Spike glycoprotein
7ls9[3] X beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. G 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7cn9[1] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7kml[7] EA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.4
5
/5
SPIKE_SARS2 Spike glycoprotein
7kxk[1] Q beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.4
2
/2
SPIKE_SARS2 Spike glycoprotein
7laa[1] K beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
6zp7[2] AA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7jw0[6] W beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. G 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7laa[1] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7cn9[1] P beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.8
5
/5
SPIKE_SARS2 Spike glycoprotein
6zgf[3] GA alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. C 100.0
/97.4
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
6zgf[3] W alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 66.7
/97.4
3
/3
A0A6B9WHD3_CVHSA Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6zgh[1] A SPIKE_SARS2 Spike glycoprotein[875 aa] C 100.0
/99.8
82
/82
SPIKE_SARS2 Spike glycoprotein
6zgh[1] A SPIKE_SARS2 Spike glycoprotein[875 aa] B 100.0
/99.8
72
/72
SPIKE_SARS2 Spike glycoprotein
7lss[1] C SPIKE_SARS2 Spike glycoprotein[785 aa] B 100.0
/99.8
56
/56
SPIKE_SARS2 Spike glycoprotein
7lss[1] A SPIKE_SARS2 Spike glycoprotein[779 aa] B 100.0
/99.8
78
/78
SPIKE_SARS2 Spike glycoprotein
7cn9[1] B SPIKE_SARS2 Spike glycoprotein[1010 aa] A 100.0
/99.8
63
/63
SPIKE_SARS2 Spike glycoprotein
7cn9[1] B SPIKE_SARS2 Spike glycoprotein[1010 aa] C 100.0
/99.7
63
/63
SPIKE_SARS2 Spike glycoprotein
7lwq[1] B SPIKE_SARS2 Spike glycoprotein[423 aa] A 100.0
/99.7
70
/70
SPIKE_SARS2 Spike glycoprotein
7lwq[1] B SPIKE_SARS2 Spike glycoprotein[423 aa] C 100.0
/99.7
49
/49
SPIKE_SARS2 Spike glycoprotein
7laa[1] E SPIKE_SARS2 Spike glycoprotein[789 aa] A 100.0
/99.7
70
/70
SPIKE_SARS2 Spike glycoprotein
7laa[1] B SPIKE_SARS2 Spike glycoprotein[788 aa] A 100.0
/99.7
84
/84
SPIKE_SARS2 Spike glycoprotein
7l3n[1] A SPIKE_SARS2 Spike glycoprotein[820 aa] B 98.7
/99.4
76
/76
SPIKE_SARS2 Spike glycoprotein
7l3n[1] A SPIKE_SARS2 Spike glycoprotein[820 aa] C 100.0
/99.4
77
/77
SPIKE_SARS2 Spike glycoprotein
7lyq[291] A SPIKE_SARS2 Spike glycoprotein[996 aa] B 100.0
/99.4
85
/85
SPIKE_SARS2 Spike glycoprotein
6zgi[40] B SPIKE_SARS2 Spike glycoprotein[1098 aa] C 100.0
/99.8
94
/94
SPIKE_SARS2 Spike glycoprotein
7k43[12] D SPIKE_SARS2 Spike glycoprotein[1034 aa] G 100.0
/99.8
86
/86
SPIKE_SARS2 Spike glycoprotein
7cws[50] O SPIKE_SARS2 Spike glycoprotein[1076 aa] M 100.0
/100.0
78
/78
SPIKE_SARS2 Spike glycoprotein
6zp1[50] A SPIKE_SARS2 Spike glycoprotein[1017 aa] C 98.6
/99.8
72
/72
SPIKE_SARS2 Spike glycoprotein
7lws[291] C SPIKE_SARS2 Spike glycoprotein[1000 aa] B 98.9
/99.4
89
/89
SPIKE_SARS2 Spike glycoprotein
7a94[40] B SPIKE_SARS2 Spike glycoprotein[1079 aa] A 100.0
/99.8
60
/60
SPIKE_SARS2 Spike glycoprotein
7lcn[3] G SPIKE_SARS2 Spike glycoprotein[993 aa] D 100.0
/99.8
84
/84
SPIKE_SARS2 Spike glycoprotein
7jw0[12] D SPIKE_SARS2 Spike glycoprotein[1007 aa] A 100.0
/99.8
47
/47
SPIKE_SARS2 Spike glycoprotein
7jjj[2] F SPIKE_SARS2 Spike glycoprotein[1108 aa] A 100.0
/99.8
9
/9
SPIKE_SARS2 Spike glycoprotein
7jjj[2] A SPIKE_SARS2 Spike glycoprotein[1120 aa] F 100.0
/99.8
12
/12
SPIKE_SARS2 Spike glycoprotein
7lcn[3] G SPIKE_SARS2 Spike glycoprotein[993 aa] A 99.0
/99.8
97
/97
SPIKE_SARS2 Spike glycoprotein
7cn8[3] A Glycoprotein[1125 aa] B 98.1
/92.0
107
/107
Glycoprotein
7cn8[3] B Glycoprotein[1125 aa] A 91.9
/92.0
111
/111
Glycoprotein
7bbh[3] C A0A6M3G9R1_9BETC Surface glycoprotein[1063 aa] A 95.7
/91.6
92
/92
A0A6M3G9R1_9BETC Surface glycoprotein
7bbh[3] B A0A6M3G9R1_9BETC Surface glycoprotein[1063 aa] A 93.9
/91.6
98
/98
A0A6M3G9R1_9BETC Surface glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6zb5[11] W EIC
LINOLEIC ACID[20 atoms]
B 100.0
/100.0
9
/9
SPIKE_SARS2 Spike glycoprotein
7cn8[5] DB EIC
LINOLEIC ACID[20 atoms]
A 100.0
/92.0
3
/3
Glycoprotein
6zb5[10] W EIC
LINOLEIC ACID[20 atoms]
C 100.0
/100.0
2
/2
SPIKE_SARS2 Spike glycoprotein
7cn8[2] DB EIC
LINOLEIC ACID[20 atoms]
B 100.0
/92.0
16
/16
Glycoprotein
6zp2[3] CA EIC
LINOLEIC ACID[20 atoms]
B 100.0
/99.8
15
/15
SPIKE_SARS2 Spike glycoprotein
7e7b[6] EB ELA
9-OCTADECENOIC ACID[20 atoms]
B 100.0
/100.0
3
/3
SPIKE_SARS2 CO1A1_HUMAN Spike glycoprotein,Collagen alpha-1(I) chain
7e7d[6] RA ELA
9-OCTADECENOIC ACID[20 atoms]
C 100.0
/100.0
13
/13
SPIKE_SARS2 CO1A1_HUMAN Spike glycoprotein,Collagen alpha-1(I) chain
6zp7[2] LA DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/99.8
5
/5
SPIKE_SARS2 Spike glycoprotein
6zp7[2] NA DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/99.8
5
/5
SPIKE_SARS2 Spike glycoprotein
6zp5[2] LA DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.