#WARNING:no index is registered index 'YP_009724389.1' in 'http://www.uniprot.org/uniprot/'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
5183 7096 500 YP_009724389.1()
QUERYSEQ
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELG
TDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNL
LEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTE
VLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAK
KVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCK
SAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSAL
NHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKP
ASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAAL
GVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCE
ESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKA
CPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICIST
KHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVD
RQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTT
VMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIIN
NARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYV
QIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDG
DMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVD
TDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQ
TVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVA
GVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALL
STDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIER
FVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHK
PPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFV
LTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEI
SMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKIL
GLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFIT
REEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYA
CWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSD
KFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTR
LQSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSV
KGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLL
LDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLND
FVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPL
KLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009724389.1()]

7096
region name description
1-7096 DISORDER predicted by DISOPRED (1-21,23-23,30-30,41-43,746-774,882-883,918-1028,1192-1245,1263-1289,1296-1324,1329-1332,1335-1352,1377-1378,1388-1388,1400-1402,1404-1404,1486-1486,1491-1492,1606-1622,2026-2058,2419-2421,2544-2546,2549-2558,2561-2562,2564-2565,2567-2579,2597-2613,2615-2619,2622-2622,2639-2651,2948-2949,3256-3276,3349-3354,3450-3460,3512-3514,3543-3544,3546-3546,3549-3551,3556-3576,3855-3861,3863-3865,3938-3941,3960-4029,4032-4037,4039-4040,4046-4049,4105-4119,4136-4167,4255-4259,4261-4263,4307-4320,4386-4404,4406-4406,4409-4411,4446-4456,4469-4481,4816-4817,4820-4820,4881-4917,4940-4944,4947-4949,4966-4966,5068-5071,5073-5077,5102-5142,5188-5203,5284-5319,5322-5325,5458-5474,5559-5568,5571-5571,5573-5583,5587-5590,5645-5645,5647-5675,5733-5753,5791-5817,5819-5823,5915-5969,6060-6060,6380-6381,6387-6387,6603-6603,6607-6607,6654-6674,6711-6713,6715-6718,6934-6945,7073-7075,7078-7096)

MONOMER
7096
pdb_id a1 identity[%]2 description
7c2k A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
6xez E 100.0 R1AB_SARS2 Helicase
5c8s B 94.9 R1AB_CVHSA Guanine-N7 methyltransferase
5s6x B 100.0 R1AB_SARS2 Uridylate-specific endoribonuclease
6wuu B 98.8 R1AB_SARS2 Non-structural protein 3
6xqt A 100.0 R1AB_SARS2 3C-like proteinase
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7bzf[20] C R1AB_SARS2 Non-structural protein 7[68 aa] A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] C R1AB_SARS2 Non-structural protein 7[73 aa] E 100.0
/100.0
1
/1
R1AB_SARS2 Helicase
7bw4[1] C R1AB_SARS2 Non-structural protein 7[65 aa] A 100.0
/100.0
10
/10
R1AB_SARS2 RNA-directed RNA polymerase
6xa9[3] B ISG15_HUMAN ISG15 CTD-propargylamide[80 aa] A 100.0
/100.0
22
/22
R1AB_SARS2 Non-structural protein 3
6xch[4] B Leupeptin[4 aa] A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
6lu7[2] B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
22
/22
R1AB_SARS2 3C-like proteinase
6lu7[2] B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
7bv1[1] D R1AB_SARS2 Non-structural protein 8[99 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
6xbi[1] C inhibitor UAW248[5 aa] A 100.0
/100.0
20
/20
R1AB_SARS2 3C-like proteinase
6xaa[1] B J3QS39_HUMAN Ubiquitin-propargylamide[76 aa] A 100.0
/100.0
25
/25
R1AB_SARS2 Non-structural protein 3
6xbh[2] B inhibitor UAW247[3 aa] A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
7cxm[2] D R1AB_SARS2 Non-structural protein 8[186 aa] I 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
7bw4[1] B R1AB_SARS2 Non-structural protein 8[115 aa] A 100.0
/100.0
42
/42
R1AB_SARS2 RNA-directed RNA polymerase
7btf[20] C R1AB_SARS2 Non-structural protein 8[126 aa] A 100.0
/100.0
51
/51
R1AB_SARS2 RNA-directed RNA polymerase
7bzf[3] D R1AB_SARS2 Non-structural protein 8[104 aa] A 100.0
/100.0
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[4] B R1AB_SARS2 Non-structural protein 8[187 aa] H 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
7cyq[1] B R1AB_SARS2 Non-structural protein 8[187 aa] G 100.0
/100.0
2
/2
R1AB_SARS2 Helicase
6nur[1] D R1A_CVHSA NSP8[109 aa] A 100.0
/97.0
2
/2
R1AB_CVHSA NSP12
7cxn[6] D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/99.9
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] B R1AB_SARS2 Non-structural protein 8[186 aa] F 100.0
/100.0
10
/10
R1AB_SARS2 Helicase
6xez[1] D R1AB_SARS2 Non-structural protein 8[186 aa] E 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
7l1f[1] B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/100.0
40
/40
R1AB_SARS2 RNA-directed RNA polymerase
6xfn[2] B UAW243[4 aa] A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
6m71[1] C R1AB_SARS2 Non-structural protein 8[43 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[1] I R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0
19
/19
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[1] D R1AB_SARS2 Non-structural protein 8[31 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7ctt[2] D R1AB_SARS2 Non-structural protein 8[28 aa] A 100.0
/100.0
2
/2
R1AB_SARS2 RNA-directed RNA polymerase
7cxn[4] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] I 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
7cxn[1] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] H 100.0
/100.0
1
/1
R1AB_SARS2 Helicase
7cxn[1] H R1AB_SARS2 Helicase[596 aa] A 100.0
/99.9
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[4] G R1AB_SARS2 Helicase[585 aa] A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6wuu[5] F VIR250[5 aa] B 100.0
/98.8
16
/16
R1AB_SARS2 Non-structural protein 3
7kvg[1] C R1AB_SARS2 Non-structural protein 4[5 aa] B 100.0
/99.7
1
/1
R1AB_SARS2 3C-like proteinase
7kvg[1] C R1AB_SARS2 Non-structural protein 4[5 aa] A 94.4
/99.7
18
/18
R1AB_SARS2 3C-like proteinase
5nfy[4] H Q1T6X8_CVHSA Polyprotein 1ab[133 aa] C 98.1
/94.7
52
/52
Q1T6X8_CVHSA Polyprotein 1ab
5c8u[6] A R1AB_CVHSA Non-structural protein 10[133 aa] B 97.9
/94.9
48
/48
R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6x1b[6] D DNA (5'-R(*GP*U)-3') B 100.0
/100.0
12
/12
R1AB_SARS2 Uridylate-specific endoribonuclease
7b3b[1] E RNA (5'-R(P*UP*GP*CP*AP*UP*CP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/100.0
28
/28
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7b3c[1] D DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*A)-D(P*(RMP))-R(.. A 100.0
/100.0
16
/16
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7c2k[1] E RNA (29-MER) A 100.0
/100.0
24
/24
R1AB_SARS2 RNA-directed RNA polymerase
7aap[1] E RNA (5'-R(P*UP*UP*AP*AP*GP*UP*UP*AP*U)-3') A 100.0
/100.0
16
/16
R1AB_SARS2 Non-structural protein 12
6xqb[1] E RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
7cxn[2] G RNA (5'-R(P*UP*UP*UP*UP*UP*U)-3') I 100.0
/100.0
20
/20
R1AB_SARS2 Helicase
7bzf[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
7bv2[1] D Primer A 100.0
/100.0
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[1] E Primer A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
7bzf[1] E RNA (31-MER) A 100.0
/100.0
25
/25
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[1] F Template A 100.0
/100.0
30
/30
R1AB_SARS2 RNA-directed RNA polymerase
7l1f[1] D RNA (5'-R(P*CP*UP*AP*AP*GP*AP*AP*GP*CP*UP*AP*UP*U*.. A 100.0
/100.0
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7ctt[1] E Primer-RNA (5'-R(P*UP*UP*CP*UP*CP*CP*UP*AP*AP*GP*A.. A 100.0
/100.0
18
/18
R1AB_SARS2 RNA-directed RNA polymerase
7b3c[1] E RNA (5'-R(P*UP*CP*AP*CP*UP*UP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/100.0
26
/26
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7aap[1] F RNA (5'-R(P*UP*UP*CP*AP*UP*AP*AP*CP*UP*UP*AP*A)-3'.. A 100.0
/100.0
23
/23
R1AB_SARS2 Non-structural protein 12
6xqb[1] F RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0
19
/19
R1AB_SARS2 RNA-directed RNA polymerase
7ctt[1] F Template-RNA (5'-R(P*AP*CP*UP*AP*GP*CP*UP*UP*CP*UP.. A 100.0
/100.0
25
/25
R1AB_SARS2 RNA-directed RNA polymerase
7b3d[1] E RNA (5'-R(P*UP*GP*CP*AP*CP*UP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/100.0
29
/29
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
6yyt[1] E RNA product A 100.0
/100.0
14
/14
R1AB_SARS2 nsp12
7l1f[1] E RNA (5'-R(P*AP*UP*UP*UP*UP*AP*AP*UP*AP*GP*CP*UP*UP.. A 100.0
/100.0
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
7c2k[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
6yyt[1] G RNA product A 100.0
/100.0
26
/26
R1AB_SARS2 nsp12
7bv2[1] E Templete A 100.0
/100.0
26
/26
R1AB_SARS2 RNA-directed RNA polymerase
7b3d[1] D RNA (5'-R(P*CP*UP*AP*CP*GP*CP*AP*GP*UP*G)-3') A 100.0
/100.0
14
/14
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7b3b[1] D DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*G)-D(P*(RMP))-R(.. A 100.0
/100.0
14
/14
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
6xez[1] G Product RNA A 100.0
/100.0
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] H Template RNA A 100.0
/100.0
21
/21
R1AB_SARS2 RNA-directed RNA polymerase
7cxm[2] E RNA (25-MER) A 100.0
/99.9
10
/10
R1AB_SARS2 RNA-directed RNA polymerase
7cxn[2] F Template RNA A 100.0
/99.9
20
/20
R1AB_SARS2 RNA-directed RNA polymerase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7lyh[2] B YHJ
benzyl (1S,3aR,6aS)-1-({(2S)-1-hydroxy-3-[(3S)-2-o..
A 100.0
/100.0
18
/18
R1AB_SARS2 3C-like proteinase
7lyh[2] B YHJ
benzyl (1S,3aR,6aS)-1-({(2S)-1-hydroxy-3-[(3S)-2-o..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rfw[2] F T8M
1-{4-[(thiophen-2-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rme[1] C RYM
4-(benzimidazol-1-ylmethyl)benzenecarbonitrile[18 ..
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rfv[2] E T8J
1-[4-(thiophene-2-carbonyl)piperazin-1-yl]ethan-1-..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rli[2] C JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rli[1] I JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5r7y[2] B JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rgv[2] B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgv[2] B UGG
2-(isoquinolin-4-yl)-N-phenylacetamide[20 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rfu[2] F T8D
1-{4-[(5-chlorothiophen-2-yl)sulfonyl]piperazin-1-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rlk[1] H NYV
1-(propan-2-yl)-1H-imidazole-4-sulfonamide[12 atom..
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rft[2] E T8A
1-[(4S)-4-phenyl-3,4-dihydroisoquinolin-2(1H)-yl]e..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rfi[2] E T71
1-{4-[(2,5-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rg0[2] F T8Y
1,1'-(piperazine-1,4-diyl)di(ethan-1-one)[12 atoms..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rfz[2] E T8V
N-(2-chloropyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rlo[1] H UQS
N-[(2-fluorophenyl)methyl]-1H-pyrazol-4-amine[14 a..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rgu[2] B UGD
N-(3-{[(2R)-4-oxoazetidin-2-yl]oxy}phenyl)-2-(pyri..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rfy[2] E T8S
1-acetyl-N-methyl-N-(propan-2-yl)piperidine-4-carb..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfx[2] E T8P
1-[4-(4-methoxyphenyl)piperazin-1-yl]ethan-1-one[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rmf[1] C NX7
(2,6-difluorophenyl)(pyrrolidin-1-yl)methanone[15 ..
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rmj[1] C JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid..
A 100.0
/100.0
10
/10
R1AB_SARS2 Helicase
5rh9[2] F UJ4
N-{4-[(1S)-1-methoxyethyl]phenyl}-N-[(1R)-2-[(4-me..
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5rh7[2] F UJ1
N-(5-tert-butyl-1H-pyrazol-3-yl)-N-[(1R)-2-[(2-eth..
A 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
5reh[2] E AWP
1-cyclohexyl-3-(2-pyridin-4-ylethyl)urea[18 atoms]..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5re8[2] E T0V
1-(3-fluorophenyl)-N-[(furan-2-yl)methyl]methanami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rlc[1] H VVM
4-amino-N-phenylbenzene-1-sulfonamide[17 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rl9[1] H UR7
1-(3-fluoro-4-methylphenyl)methanesulfonamide[13 a..
B 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5re7[2] E T0S
N-[(4-sulfamoylphenyl)methyl]acetamide[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rlb[1] C VVJ
N-cycloheptyl-N-methylmethanesulfonamide[13 atoms]..
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rl8[1] D VVG
N-(2-fluorophenyl)ethanesulfonamide[13 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rl8[1] C VVG
N-(2-fluorophenyl)ethanesulfonamide[13 atoms]
A 100.0
/100.0
10
/10
R1AB_SARS2 Helicase
5rmh[1] C VX4
[(4S)-4-methylazepan-1-yl](1,3-thiazol-4-yl)methan..
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rl7[1] I VVD
5-(acetylamino)-2-fluorobenzoic acid[14 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rl7[1] C VVD
5-(acetylamino)-2-fluorobenzoic acid[14 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rmk[1] H O2A
N-methyl-1H-indole-7-carboxamide[13 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
5reb[2] E T0Y
1-[(thiophen-3-yl)methyl]piperidin-4-ol[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5s70[3] E WUS
(5R)-2-methyl-4,5,6,7-tetrahydro-1H-benzimidazol-5..
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
5re9[2] E LPZ
2-(4-methylphenoxy)-1-(4-methylpiperazin-4-ium-1-y..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rml[1] H VXD
N-(3-chloro-2-methylphenyl)glycinamide[13 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rmm[1] H VXG
(3S,4R)-1-acetyl-4-phenylpyrrolidine-3-carboxylic ..
B 100.0
/100.0
10
/10
R1AB_SARS2 Helicase
6wlc[6] M U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
7k0r[6] K U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms]
C 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
7nng[2] C UJK
1-(2-Methylphenyl)-1H-1,2,3-triazole-4-carboxylic ..
A 100.0
/100.0
8
/8
R1AB_SARS2 SARS-CoV-2 helicase NSP13
5rer[2] E T3J
1-[(2R)-2-(4-fluorophenyl)morpholin-4-yl]ethan-1-o..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
7k40[8] B U5G
boceprevir (bound form)[37 atoms]
A 100.0
/100.0
18
/18
R1AB_SARS2 3C-like proteinase
5s71[6] F WUV
5'-thiothymidine[17 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
5s71[6] F WUV
5'-thiothymidine[17 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
7los[2] E Y97
5-(azetidin-3-ylamino)-2-methyl-~{N}-[(1~{R})-1-[3..
A 100.0
/100.0
11
/11
R1A_SARS2 Non-structural protein 3
5rgx[2] B UGP
2-(3-cyanophenyl)-N-(4-methylpyridin-3-yl)acetamid..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rfl[2] E T7G
1-acetyl-N-(2-hydroxyphenyl)piperidine-4-carboxami..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfk[2] E T7D
N-(1-acetylpiperidin-4-yl)benzamide[18 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rf8[2] E SFY
4-amino-N-(pyridin-2-yl)benzenesulfonamide[17 atom..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rfm[2] E T7J
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5s72[3] D WUY
N-(2-aminoethyl)-N'-phenylurea[13 atoms]
A 100.0
/100.0
10
/10
R1AB_SARS2 Uridylate-specific endoribonuclease
5s72[3] D WUY
N-(2-aminoethyl)-N'-phenylurea[13 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
7k1o[6] D VQV
1-(3,5-di-O-phosphono-alpha-L-xylofuranosyl)pyrimi..
A 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
5rlf[1] C NY7
N-(2-methoxy-5-methylphenyl)glycinamide[14 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
6xr3[2] B V7G
N-[(2S)-1-({(1S,2S)-1-(1,3-benzothiazol-2-yl)-1-hy..
A 100.0
/100.0
18
/18
R1AB_SARS2 3C-like proteinase
5rfo[2] E T7S
1-[4-(piperidine-1-carbonyl)piperidin-1-yl]ethan-1..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfn[2] E T7P
N-[(3R)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rfp[2] E T7V
N-[(1S)-1-(3-chlorophenyl)ethyl]acetamide[13 atoms..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5s6y[3] F WUJ
N-[(furan-2-yl)methyl]urea[10 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
5s6y[3] D WUJ
N-[(furan-2-yl)methyl]urea[10 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
5rm1[1] H RY4
N-[4-(aminomethyl)phenyl]methanesulfonamide[13 ato..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rfs[2] F T84
1-{4-[(thiophen-3-yl)methyl]piperazin-1-yl}ethan-1..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
7bgp[6] L ALD
N-[(benzyloxy)carbonyl]-L-leucyl-N-[(2S)-1-hydroxy..
B 100.0
/100.0
15
/15
R1AB_SARS2 Main Protease
5s6z[6] F WUM
4-[(dimethylamino)methyl]-1,3-thiazol-2-amine[10 a..
B 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
5r84[2] B GWS
2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide[16 atoms..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rlj[1] H VW4
(2S)-2-phenylpropane-1-sulfonamide[13 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
7bv2[1] K F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-..
A 100.0
/100.0
7
/7
R1AB_SARS2 RNA-directed RNA polymerase
5rlg[1] C VW1
(2S)-2-(4-cyanophenoxy)propanamide[14 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rll[1] H H04
1-(2-ethoxyphenyl)piperazine[15 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rh2[2] B UH7
2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)acetami..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rh0[2] B UH4
N-(5-methylthiophen-2-yl)-N'-pyridin-3-ylurea[16 a..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgz[2] B UH1
2-(3-cyanophenyl)-N-(pyridin-3-yl)acetamide[18 ato..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
6wxc[6] M CMU
5-CHLORO-6-(1-(2-IMINOPYRROLIDINYL) METHYL) URACIL..
B 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
5ref[2] E 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rmc[1] H 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rem[2] E T2J
1 1-(4-(2-nitrophenyl)piperazin-1-yl)ethan-1-one[1..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rm4[1] H PK4
2-fluoro-N,3-dimethylbenzene-1-sulfonamide[13 atom..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rgw[2] B UGM
2-(5-cyanopyridin-3-yl)-N-(pyridin-3-yl)acetamide[..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rel[2] E T2G
1-{4-[(3-methylphenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5reo[2] E T2Y
N-[(2H-1,3-benzodioxol-5-yl)methyl]acetamide[14 at..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rm7[1] H N0E
~{N}-(4-hydroxyphenyl)-3-phenyl-propanamide[18 ato..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rlt[1] H UVJ
3-(2-methyl-1H-benzimidazol-1-yl)propanamide[15 at..
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5re4[2] E SZY
N-(4-methylpyridin-3-yl)acetamide[11 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
7lbs[2] J XR8
5-[(azetidin-3-yl)amino]-2-methyl-N-[(1R)-1-(3-{5-..
B 100.0
/100.0
11
/11
R1A_SARS2 Non-structural protein 3
5rgy[2] B UGS
N-(4-methoxypyridin-2-yl)-2-(naphthalen-2-yl)aceta..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5s6x[6] D WUG
1-(2,4-dimethyl-1H-imidazol-5-yl)methanamine[9 ato..
A 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
7k1l[6] C UVC
URIDINE-2',3'-VANADATE[21 atoms]
A 100.0
/100.0
13
/13
R1AB_SARS2 Uridylate-specific endoribonuclease
5rlu[1] I JG4
2-(thiophen-2-yl)-1H-imidazole[10 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rlu[1] C JG4
2-(thiophen-2-yl)-1H-imidazole[10 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
5ren[2] E T2V
1-[(3R)-3-(1,3-benzothiazol-2-yl)piperidin-1-yl]et..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rg2[2] E T9M
N~2~-acetyl-N-prop-2-en-1-yl-D-allothreoninamide[1..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rhf[2] F UPJ
1-acetyl-N-methyl-N-phenylpiperidine-4-carboxamide..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
7aap[2] M GE6
[[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-5-f..
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 12
5rg1[2] E T9J
Nalpha-acetyl-N-(3-bromoprop-2-yn-1-yl)-L-tyrosina..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5rl6[1] H LJA
N-[3-(carbamoylamino)phenyl]acetamide[14 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rhe[2] B UPD
1-acetyl-N-(6-methoxypyridin-3-yl)piperidine-4-car..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
7keh[6] E B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR..
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
7keh[3] E B3P
2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PR..
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
5rfe[2] E JGG
N-[(4-cyanophenyl)methyl]morpholine-4-carboxamide[..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5red[2] E JJG
4-[2-(phenylsulfanyl)ethyl]morpholine[15 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rgh[2] E U0M
5-fluoro-1-[(5-methyl-1,3,4-thiadiazol-2-yl)methyl..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rea[2] E JGP
(azepan-1-yl)(2H-1,3-benzodioxol-5-yl)methanone[18..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rg3[2] F T9P
N~2~-acetyl-N~1~-prop-2-en-1-yl-L-aspartamide[15 a..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rh4[2] B UHG
(2R)-2-(6-chloro-9H-carbazol-2-yl)propanoic acid[1..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rm3[1] C S7J
2-(trifluoromethyl)pyrimidine-5-carboxamide[13 ato..
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rmd[2] I VWY
N-ethyl-4-[(methylsulfonyl)amino]benzamide[16 atom..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rh3[2] B UHA
(2R)-2-(3-chlorophenyl)-N-(4-methylpyridin-3-yl)pr..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5ree[2] E T1M
(2R,3R)-1-benzyl-2-methylpiperidin-3-ol[15 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rmb[1] C VWV
ethyl (1,1-dioxo-1lambda~6~,4-thiazinan-4-yl)aceta..
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rh8[2] F UHM
2-(cyanomethoxy)-N-[(1,2-thiazol-4-yl)methyl]benza..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rf9[2] E S7D
1-[(2~{S})-2-methylmorpholin-4-yl]-2-pyrazol-1-yl-..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rec[2] E T1J
2-{[(1H-benzimidazol-2-yl)amino]methyl}phenol[18 a..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5reu[2] E T4D
2-[(4-acetylpiperazin-1-yl)sulfonyl]benzonitrile[2..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
5rm6[1] H HR5
~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-ca..
B 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rej[2] E T1V
1-{4-[(thiophen-2-yl)sulfonyl]piperazin-1-yl}ethan..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
7nn0[4] Q ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
C 100.0
/100.0
12
/12
R1AB_SARS2 SARS-CoV-2 helicase NSP13
5rf6[2] E NTG
5-(1,4-oxazepan-4-yl)pyridine-2-carbonitrile[15 at..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rlv[1] D VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rlv[1] J VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rlv[1] C VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
6x4i[6] C U3P
3'-URIDINEMONOPHOSPHATE[21 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
5rlr[1] H VWD
(1R)-2-(methylsulfonyl)-1-phenylethan-1-ol[13 atom..
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rln[1] C NZG
3-(acetylamino)-4-fluorobenzoic acid[14 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rls[1] C VWG
N-hydroxyquinoline-2-carboxamide[14 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rlp[1] H VWA
(1S)-1-(4-fluorophenyl)-N-methylethan-1-amine[11 a..
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rgs[2] E S7V
[(2~{R})-4-(phenylmethyl)morpholin-2-yl]methanol[1..
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
6xb2[2] C NEN
1-ETHYL-PYRROLIDINE-2,5-DIONE[9 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6xb1[4] B NEN
1-ETHYL-PYRROLIDINE-2,5-DIONE[9 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rey[2] E T4Y
1-{4-[(2-methylphenyl)methyl]-1,4-diazepan-1-yl}et..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
7lyi[2] D YHI
benzyl (1R,2S,5S)-2-({(2S)-1-hydroxy-3-[(3S)-2-oxo..
A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
7llz[2] C Y61
N-[(1R)-1-(3-{5-[(acetylamino)methyl]thiophen-2-yl..
A 100.0
/100.0
11
/11
R1A_SARS2 Non-structural protein 3
7k6e[8] C SV6
(1S,3aR,6aS)-2-[(2S)-2-({(2S)-2-cyclohexyl-2-[(pyr..
A 100.0
/100.0
18
/18
R1AB_SARS2 3C-like proteinase
6m0k[2] F FJC
~{N}-[(2~{S})-3-(3-fluorophenyl)-1-oxidanylidene-1..
A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
7d4f[1] G H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal..
D 100.0
/100.0
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7d4f[1] H H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal..
D 100.0
/100.0
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
5rex[2] E T4V
1-{4-[(naphthalen-1-yl)methyl]piperazin-1-yl}ethan..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rma[1] H JHJ
N-(4-methoxyphenyl)-N'-pyridin-4-ylurea[18 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5re5[2] E T0J
N~1~-phenylpiperidine-1,4-dicarboxamide[18 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rev[2] E T4J
N-[3-(thiomorpholine-4-carbonyl)phenyl]acetamide[1..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rhb[2] G USD
(E)-1-(pyrimidin-2-yl)methanimine[8 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rew[2] E T4M
N-[(1R)-1-(naphthalen-1-yl)ethyl]acetamide[16 atom..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rle[1] H VVP
4-methoxy-1H-indole[11 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rf5[2] E HV2
1,1-bis(oxidanylidene)thietan-3-ol[7 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rmg[1] H MUK
4,6-dimethyl-~{N}-phenyl-pyrimidin-2-amine[15 atom..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
7ju7[2] B G65
Masitinib[36 atoms]
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
7lbr[2] F XT7
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1S,3R..
A 100.0
/100.0
11
/11
R1A_SARS2 Non-structural protein 3
5rfj[2] E T7A
N-(4-methoxy-1,3-benzothiazol-2-yl)acetamide[15 at..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5r7z[2] E HWH
~{N}-[2-(5-fluoranyl-1~{H}-indol-3-yl)ethyl]ethana..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rm2[1] I UXG
1-(diphenylmethyl)azetidin-3-ol[18 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rm2[1] H UXG
1-(diphenylmethyl)azetidin-3-ol[18 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
6wtk[2] B UED
N~2~-[(benzyloxy)carbonyl]-N-{(2S)-1-hydroxy-3-[(3..
A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
5r83[2] E K0G
N-phenyl-N'-pyridin-3-ylurea[16 atoms]
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgk[2] E U0V
2-fluoro-N-[2-(pyridin-4-yl)ethyl]benzamide[18 ato..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rgj[2] E U0S
(5S)-7-(pyrazin-2-yl)-2-oxa-7-azaspiro[4.4]nonane[..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rgi[2] E U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgi[2] E U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rm5[1] H NUA
N-(1-ethyl-1H-pyrazol-4-yl)cyclobutanecarboxamide[..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rl4[2] F VEV
N-(4-tert-butylphenyl)-N-[(1R)-2-(methylamino)-2-o..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rlm[1] H VW7
N-(8-methyl-1,2,3,4-tetrahydroquinolin-5-yl)acetam..
B 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
5rl3[2] F VEP
N-(4-tert-butylphenyl)-N-[(1R)-2-[(oxan-4-yl)amino..
A 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
6w63[2] B X77
N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclohexylamino)..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rfr[2] E T81
1-{4-[(5-bromothiophen-2-yl)methyl]piperazin-1-yl}..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rgl[2] E U0Y
1-[4-(4-methylbenzene-1-carbonyl)piperazin-1-yl]et..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
7llf[2] N Y54
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1R,3S..
B 100.0
/100.0
11
/11
R1A_SARS2 Non-structural protein 3
5rl5[2] F VEY
N-(4-tert-butylphenyl)-N-[(1R)-2-(ethylamino)-2-ox..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5rlw[1] I S9S
~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1..
B 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rlw[1] C S9S
~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1..
A 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
5rl0[2] B VEG
ethyl N-[(2R)-2-[(4-tert-butylphenyl)(propanoyl)am..
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
5rl2[2] B VEM
N-(4-tert-butylphenyl)-N-[(1R)-2-[(2-methoxyethyl)..
A 100.0
/100.0
18
/18
R1AB_SARS2 3C-like proteinase
5rl1[2] B VEJ
N-(4-tert-butylphenyl)-N-[(1R)-2-[(3-methoxypropyl..
A 100.0
/100.0
19
/19
R1AB_SARS2 3C-like proteinase
7cyq[1] L GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 RNA-directed RNA polymerase
7jq2[2] B VHM
N-[(benzyloxy)carbonyl]-L-valyl-3-cyclohexyl-N-{(2..
A 100.0
/100.0
21
/21
R1AB_SARS2 3C-like proteinase
7jq2[2] B VHM
N-[(benzyloxy)carbonyl]-L-valyl-3-cyclohexyl-N-{(2..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rgp[2] E U1M
1-{4-[(2,4-dimethylphenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
10
/10
R1AB_SARS2 3C-like proteinase
6m2n[4] F 3WL
5,6,7-trihydroxy-2-phenyl-4H-chromen-4-one[20 atom..
B 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
5rgn[2] E U1A
1-{4-[(4-methylphenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rep[2] E T3G
1-{4-[(2,6-difluorophenyl)sulfonyl]piperazin-1-yl}..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfc[2] E K1Y
methyl (2-methyl-4-phenyl-1,3-thiazol-5-yl)carbama..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5ret[2] E T47
1-{4-[(3-chlorophenyl)methyl]piperazin-1-yl}ethan-..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgm[2] E U1D
N'-acetyl-4,5,6,7-tetrahydro-1-benzothiophene-2-ca..
A 100.0
/100.0
12
/12
R1AB_SARS2 3C-like proteinase
5rgo[2] E U1G
1-[4-(furan-2-carbonyl)piperazin-1-yl]ethan-1-one[..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rgr[2] E K1G
N,1-dimethyl-N-(propan-2-yl)-1H-pyrazolo[3,4-d]pyr..
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rgr[2] D K1G
N,1-dimethyl-N-(propan-2-yl)-1H-pyrazolo[3,4-d]pyr..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5res[2] E T3V
1-{4-[(2-fluorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
7buy[2] B JRY
hexylcarbamic acid[9 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rgq[2] D U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rgq[2] D U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rly[1] I K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rly[1] C K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Helicase
5rly[1] J K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
6wtj[4] B K36
(1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
6wtj[2] B K36
(1S,2S)-2-({N-[(benzyloxy)carbonyl]-L-leucyl}amino..
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rfh[2] E T6Y
1-{4-[(5-chlorothiophen-2-yl)methyl]piperazin-1-yl..
A 100.0
/100.0
11
/11
R1AB_SARS2 3C-like proteinase
5rm8[1] C GQJ
methyl (2~{S},4~{R})-1-(furan-2-ylcarbonyl)-4-oxid..
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rhc[2] B USA
(E)-1-(1H-imidazol-2-yl)methanimine[7 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
5rfg[2] E T6V
N-[(3S)-1,1-dioxo-2,3-dihydro-1H-1lambda~6~-thioph..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
7krx[2] B Y41
3-amino-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
5rff[2] E T6M
1-{4-[(4-chlorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rm0[1] H S7G
~{N}-[(3~{R})-1,2,3,4-tetrahydroquinolin-3-yl]etha..
B 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
5rfd[2] E T6J
2-[(methylsulfonyl)methyl]-1H-benzimidazole[14 ato..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
7ltj[2] B YD1
6-[4-(3,4-dichlorophenyl)piperazin-1-yl]carbonyl-1..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
5reg[2] E LWA
(2~{S})-~{N}-(4-aminocarbonylphenyl)oxolane-2-carb..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rh5[2] B UHV
N-(5-tert-butyl-1,2-oxazol-3-yl)-N-[(1R)-2-[(4-met..
A 100.0
/100.0
16
/16
R1AB_SARS2 3C-like proteinase
6xez[2] Y ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
F 100.0
/100.0
9
/9
R1AB_SARS2 Helicase
6xez[1] L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/100.0
11
/11
R1AB_SARS2 RNA-directed RNA polymerase
5rlz[1] C VWM
(3R)-1-acetyl-3-hydroxypiperidine-3-carboxylic aci..
A 100.0
/100.0
8
/8
R1AB_SARS2 Helicase
5rlh[1] H K2P
2-(trifluoromethoxy)benzoic acid[14 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rez[2] E T54
(1R,2S)-2-(thiophen-3-yl)cyclopentane-1-carboxamid..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rgt[2] F UHS
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/100.0
14
/14
R1AB_SARS2 3C-like proteinase
5r80[2] E RZG
methyl 4-sulfamoylbenzoate[14 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rf4[2] E T5Y
pyridin-2-ol[7 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5re6[2] E O0S
N-{4-[(pyrimidin-2-yl)oxy]phenyl}acetamide[17 atom..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rei[2] E T1S
4-[(3-chlorophenyl)methyl]morpholine[14 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5r81[2] B RZJ
1-methyl-3,4-dihydro-2~{H}-quinoline-7-sulfonamide..
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
5rf3[2] E T5V
pyrimidin-5-amine[7 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rmi[1] C STV
~{N}-(1,3-benzodioxol-5-ylmethyl)ethanesulfonamide..
A 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
6xez[1] U 1N7
CHAPSO[36 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] N 1N7
CHAPSO[26 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] M 1N7
CHAPSO[35 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] U 1N7
CHAPSO[36 atoms]
E 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
5r82[2] B RZS
6-(ethylamino)pyridine-3-carbonitrile[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rgg[2] E NZD
4-methyl-N-phenylpiperazine-1-carboxamide[16 atoms..
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf0[2] E T5D
[1-(pyridin-2-yl)cyclopentyl]methanol[13 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rf0[2] E T5D
[1-(pyridin-2-yl)cyclopentyl]methanol[13 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rm9[1] H EJQ
~{N}-(4-fluorophenyl)-2-pyrrolidin-1-yl-ethanamide..
B 100.0
/100.0
10
/10
R1AB_SARS2 Helicase
5rf1[2] E T5G
4-bromobenzene-1-sulfonamide[11 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rfb[2] E K3S
N-[(1-methyl-1H-1,2,3-triazol-4-yl)methyl]ethanami..
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rf7[2] E T67
1-(4-methylpiperazin-1-yl)-2-(1H-pyrrolo[2,3-b]pyr..
A 100.0
/100.0
13
/13
R1AB_SARS2 3C-like proteinase
5rld[1] H VVY
2-phenoxy-1-(pyrrolidin-1-yl)ethan-1-one[15 atoms]..
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rek[2] E T1Y
1-{4-[(3-fluorophenyl)sulfonyl]piperazin-1-yl}etha..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
5rhd[2] I US7
1-[4-(methylsulfonyl)phenyl]piperazine[16 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 3C-like proteinase
7l0d[2] B 0EN
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/100.0
17
/17
R1AB_SARS2 3C-like proteinase
5rfq[2] E T7Y
N-[3-(2-oxopyrrolidin-1-yl)phenyl]acetamide[16 ato..
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
7m1y[2] S 9JT
~{N}-phenyl-2-selanyl-benzamide[16 atoms]
B 100.0
/99.7
6
/6
R1A_SARS2 Papain-like protease
7bfb[1] O 9JT
~{N}-phenyl-2-selanyl-benzamide[7 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Main Protease
7bfb[1] L 9JT
~{N}-phenyl-2-selanyl-benzamide[7 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Main Protease
5rlq[1] C UVA
N-methyl-2-(methylsulfonyl)aniline[12 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
5rh6[2] F UHY
N-[(1R)-2-[(2-ethyl-6-methylphenyl)amino]-2-oxo-1-..
A 100.0
/100.0
15
/15
R1AB_SARS2 3C-like proteinase
7e35[1] F GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen..
B 100.0
/99.7
10
/10
R1AB_SARS2 Non-structural protein 3
7e35[1] D GYX
N-[(3-acetamidophenyl)methyl]-1-[(1R)-1-naphthalen..
B 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
7jir[1] B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
7cmd[4] M TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
C 100.0
/100.0
10
/10
R1AB_SARS2 Non-structural protein 3
7jit[1] B Y95
5-[(carbamoylcarbamoyl)amino]-2-methyl-N-[(1R)-1-(..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
7kol[2] B Y96
5-[(E)-(hydroxyimino)methyl]-2-methyl-N-[(1R)-1-(n..
A 100.0
/100.0
11
/11
R1A_SARS2 Papain-like protease
7koj[1] B Y94
2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl]-5-{[(pr..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
7jiv[1] B VBY
5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1..
A 100.0
/99.7
11
/11
R1A_SARS2 Papain-like protease
5c8s[2] S SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
D 100.0
/94.9
15
/15
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[2] R SAM
S-ADENOSYLMETHIONINE[27 atoms]
D 100.0
/94.9
15
/15
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[2] T G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms..
D 100.0
/94.9
16
/16
R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rlr[112] J ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
5rmb[112] E ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
7nn0[18] K ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 helicase NSP13
5rm2[112] C ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
7jrn[46] H ZN
ZINC ION[1 atoms]
B 100.0
/100.0
5
/5
R1A_SARS2 Non-structural protein 3
7jiv[10] F ZN
ZINC ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
5nfy[4] R ZN
ZINC ION[1 atoms]
C 100.0
/94.7
4
/4
Q1T6X8_CVHSA Polyprotein 1ab
6xqb[4] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7c2k[3] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
5c8u[4] M ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u[4] O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7bw4[1] F ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
6w9c[3] H ZN
ZINC ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Non-structural protein 3
7nn0[11] P ZN
ZINC ION[1 atoms]
C 100.0
/100.0
4
/4
R1AB_SARS2 SARS-CoV-2 helicase NSP13
7bv2[4] F ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
5nfy[4] W ZN
ZINC ION[1 atoms]
D 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5wwp[11] C ZN
ZINC ION[1 atoms]
A 100.0
/72.3
4
/4
K0BWD0_9BETC ORF1ab
6xez[2] V ZN
ZINC ION[1 atoms]
F 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
7kol[2] F ZN
ZINC ION[1 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Papain-like protease
6yyt[4] I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
5nfy[4] N ZN
ZINC ION[1 atoms]
B 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
6yyt[4] J ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 nsp12
6xez[2] X ZN
ZINC ION[1 atoms]
F 100.0
/100.0
4
/4
R1AB_SARS2 Helicase
7cxm[8] K ZN
ZINC ION[1 atoms]
A 100.0
/99.9
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
7cjm[1] C ZN
ZINC ION[1 atoms]
A 100.0
/99.7
1
/1
R1AB_SARS2 Non-structural protein 3
5c8s[2] I ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[2] G ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
6xez[8] I ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
5c8t[4] O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7d6h[1] B ZN
ZINC ION[1 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7bw4[1] E ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
5c8s[2] P ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7jiv[8] E ZN
ZINC ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
6nur[3] E ZN
ZINC ION[1 atoms]
A 100.0
/97.0
4
/4
R1AB_CVHSA NSP12
7cjm[1] D ZN
ZINC ION[1 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
7jiv[16] J CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
7kol[2] J CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
5
/5
R1A_SARS2 Papain-like protease
6xkf[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
6w9c[9] E CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
7
/7
R1A_SARS2 Non-structural protein 3
7kol[3] I CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Papain-like protease
6wzu[2] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
5r7y[2] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6wzu[9] G CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Non-structural protein 3
6vww[3] L CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
7m1y[2] E CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7los[1] M CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
1
/1
R1A_SARS2 Non-structural protein 3
7nf5[2] K CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Main Protease
7nfv[1] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1A_SARS2 Non-structural protein 3
7be7[1] T CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Main Protease
7bb2[1] L CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Main Protease
7nfv[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Non-structural protein 3
7lyi[4] C NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
7be7[3] S NA
SODIUM ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Main Protease
7m1y[2] CA NA
SODIUM ION[1 atoms]
B 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7nf5[3] L NA
SODIUM ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Main Protease
6x4i[3] P NA
SODIUM ION[1 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
7d47[1] D CA
CALCIUM ION[1 atoms]
A 100.0
/99.7
1
/1
R1A_SARS2 Non-structural protein 3
7m1y[2] Q IOD
IODIDE ION[1 atoms]
B 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
7m1y[1] Y IOD
IODIDE ION[1 atoms]
B 100.0
/99.7
1
/1
R1A_SARS2 Papain-like protease
7m1y[2] H IOD
IODIDE ION[1 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7m1y[2] J IOD
IODIDE ION[1 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7m1y[2] G IOD
IODIDE ION[1 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
7m1y[2] AA IOD
IODIDE ION[1 atoms]
B 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
7m1y[2] R IOD
IODIDE ION[1 atoms]
B 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
7krx[19] M UNX
UNKNOWN ATOM OR ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
7koj[11] M UNX
UNKNOWN ATOM OR ION[1 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
6xez[2] AA MG
MAGNESIUM ION[1 atoms]
F 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
6wuu[1] K MG
MAGNESIUM ION[1 atoms]
B 100.0
/98.8
1
/1
R1AB_SARS2 Non-structural protein 3
6vww[3] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6wuu[1] O MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
5
/5
R1AB_SARS2 Non-structural protein 3
5c8s[2] J MG
MAGNESIUM ION[1 atoms]
B 100.0
/94.9
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
6xez[3] K MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
5c8t[4] Q MG
MAGNESIUM ION[1 atoms]
D 100.0
/94.9
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
7ctt[2] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6wuu[1] M MG
MAGNESIUM ION[1 atoms]
C 100.0
/99.7
1
/1
R1AB_SARS2 Non-structural protein 3
6xqb[3] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7nn0[1] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 SARS-CoV-2 helicase NSP13
6wuu[1] P MG
MAGNESIUM ION[1 atoms]
D 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rgm[349] A R1AB_SARS2 3C-like proteinase[304 aa] A 100.0
/100.0
37
/37
R1AB_SARS2 3C-like proteinase
7kvg[2] B R1AB_SARS2 3C-like proteinase[306 aa] A 100.0
/99.7
37
/37
R1AB_SARS2 3C-like proteinase
7cxn[2] H R1AB_SARS2 Helicase[596 aa] I 100.0
/100.0
3
/3
R1AB_SARS2 Helicase
7cyq[1] G R1AB_SARS2 Helicase[585 aa] H 100.0
/100.0
1
/1
R1AB_SARS2 Helicase
7cxm[2] I R1AB_SARS2 Helicase[596 aa] H 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
7nio[2] B R1AB_SARS2 SARS-CoV-2 helicase NSP13[585 aa] A 100.0
/100.0
14
/14
R1AB_SARS2 SARS-CoV-2 helicase NSP13
6xez[1] E R1AB_SARS2 Helicase[596 aa] F 100.0
/100.0
5
/5
R1AB_SARS2 Helicase
7cyq[2] H R1AB_SARS2 Helicase[586 aa] G 100.0
/100.0
2
/2
R1AB_SARS2 Helicase
5s6x[114] A R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] B 100.0
/100.0
14
/15
R1AB_SARS2 Uridylate-specific endoribonuclease
7k1l[54] B R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] B 100.0
/100.0
26
/26
R1AB_SARS2 Uridylate-specific endoribonuclease
7keg[60] A R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] A 100.0
/100.0
27
/27
R1AB_SARS2 Uridylate-specific endoribonuclease
7k1o[54] A R1AB_SARS2 Uridylate-specific endoribonuclease[346 aa] C 100.0
/100.0
25
/25
R1AB_SARS2 Uridylate-specific endoribonuclease
7k9p[6] A R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] B 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
7k9p[60] A R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] A 100.0
/100.0
23
/23
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[12] B R1AB_SARS2 Uridylate-specific endoribonuclease[347 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
7k0r[6] E R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] C 100.0
/100.0
12
/12
R1AB_SARS2 Uridylate-specific endoribonuclease
7k0r[4] A R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] F 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
5s6z[12] B R1AB_SARS2 Uridylate-specific endoribonuclease[348 aa] A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
7k0r[6] B R1AB_SARS2 Uridylate-specific endoribonuclease[345 aa] C 100.0
/100.0
20
/20
R1AB_SARS2 Uridylate-specific endoribonuclease
6w9c[11] A R1A_SARS2 Non-structural protein 3[310 aa] C 100.0
/100.0
4
/4
R1A_SARS2 Non-structural protein 3
7cjd[1] B R1AB_SARS2 Non-structural protein 3[297 aa] A 100.0
/99.7
10
/10
R1AB_SARS2 Non-structural protein 3
6xg3[2] A R1AB_SARS2 Non-structural protein 3[313 aa] A 100.0
/99.7
24
/24
R1AB_SARS2 Non-structural protein 3
7cjd[1] D R1AB_SARS2 Non-structural protein 3[310 aa] A 100.0
/99.7
14
/14
R1AB_SARS2 Non-structural protein 3
7e35[1] A R1AB_SARS2 Non-structural protein 3[287 aa] B 100.0
/99.7
21
/21
R1AB_SARS2 Non-structural protein 3
2rhb[12] F R1AB_CVHSA Uridylate-specific endoribonuclease[344 aa] D 86.7
/88.4
30
/30
R1AB_CVHSA Uridylate-specific endoribonuclease
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 85.2
/88.2
27
/27
Q6VA80_CVHSA Putative orf1ab polyprotein
2rhb[6] C R1AB_CVHSA Uridylate-specific endoribonuclease[345 aa] F 92.9
/88.4
14
/14
R1AB_CVHSA Uridylate-specific endoribonuclease
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 93.3
/88.2
15
/16
Q6VA80_CVHSA Putative orf1ab polyprotein
2rhb[6] F R1AB_CVHSA Uridylate-specific endoribonuclease[344 aa] E 88.0
/88.4
25
/25
R1AB_CVHSA Uridylate-specific endoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
7096 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6vww[3] N GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[6] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
7ju7[2] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
7lbs[1] N GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
6
/6
R1A_SARS2 Non-structural protein 3
6vww[6] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6xbi[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
6xa9[16] I GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6xa9[2] L GOL
GLYCEROL[6 atoms]
C 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
6wrh[4] I GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
6
/6
R1AB_SARS2 Non-structural protein 3
6xa9[3] K GOL
GLYCEROL[6 atoms]
C 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
6wzu[2] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Non-structural protein 3
6xa9[1] P GOL
GLYCEROL[6 atoms]
E 100.0
/100.0
2
/2
R1AB_SARS2 Non-structural protein 3
6vww[3] I GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
7lyh[2] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
7lbs[1] M GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
6
/6
R1A_SARS2 Non-structural protein 3
7llf[2] O GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
R1A_SARS2 Non-structural protein 3
6vww[3] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
7ju7[2] E GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
6xbi[1] E GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
7lyh[2] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
7nfv[1] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
6
/6
R1A_SARS2 Non-structural protein 3
7lbr[1] G GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Non-structural protein 3
5rf2[2] E HVB
1-azanylpropylideneazanium[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
7nf5[2] F IPA
ISOPROPYL ALCOHOL[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Main Protease
7nf5[4] G IPA
ISOPROPYL ALCOHOL[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Main Protease
7nf5[2] F IPA
ISOPROPYL ALCOHOL[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Main Protease
7nf5[2] I IPA
ISOPROPYL ALCOHOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Main Protease
5rlr[216] L PO4
PHOSPHATE ION[5 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
6xg3[3] C PO4
PHOSPHATE ION[5 atoms]
A 83.3
/99.7
6
/6
R1AB_SARS2 Non-structural protein 3
7keg[6] C PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
6wrh[2] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Non-structural protein 3
7k0r[6] L PO4
PHOSPHATE ION[5 atoms]
C 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[12] N PO4
PHOSPHATE ION[5 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6wzu[2] E PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Non-structural protein 3
7nfv[1] E PO4
PHOSPHATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1A_SARS2 Non-structural protein 3
7d6h[1] C PO4
PHOSPHATE ION[5 atoms]
A 83.3
/99.7
6
/6
R1A_SARS2 Papain-like protease
6xdh[3] K ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[6] H ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
7koj[6] K ACT
ACETATE ION[4 atoms]
A 85.7
/99.7
7
/7
R1A_SARS2 Papain-like protease
6wlc[5] T ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[6] C ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] S ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] Q ACT
ACETATE ION[4 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
7krx[2] I ACT
ACETATE ION[4 atoms]
A 100.0
/99.7
2
/2
R1A_SARS2 Papain-like protease
7k1l[3] E ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] F ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
6xkh[2] H ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6x4i[12] N EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[21] O EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[12] R EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[31] F EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[21] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
7be7[1] M EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Main Protease
6wlc[29] P EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[6] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
7jfq[7] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1AB_SARS2 3C-like proteinase
6wlc[24] W EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
7bgp[8] N EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Main Protease
7be7[1] Q EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Main Protease
6x1b[3] G EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[3] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
7be7[1] F EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Main Protease
6wlc[18] E EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[9] U EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[6] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[6] S EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] L EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[12] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
6x1b[3] H EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] M EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] V EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6x4i[3] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[9] O EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
7k1l[3] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6xkh[2] B EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6wlc[3] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
7nf5[2] C EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Main Protease
7bb2[4] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Main Protease
7nf5[2] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Main Protease
7k1l[3] F EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
R1AB_SARS2 Uridylate-specific endoribonuclease
7bb2[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Main Protease
6x4i[3] X EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
7nf5[2] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 Main Protease
6xkf[2] C EDO
1,2-ETHANEDIOL[4 atoms]
A 80.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
6w01[3] S EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
7nf5[2] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Main Protease
7bb2[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Main Protease
6xkh[2] C EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
7aap[1] K POP
PYROPHOSPHATE 2-[9 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Non-structural protein 12
7bv2[1] H POP
PYROPHOSPHATE 2-[9 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
5rg3[244] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
5rf1[260] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
5rf1[256] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rf7[238] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5rgy[57] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
5rgy[12] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
5rh6[58] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
7k3t[20] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
5rfp[14] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
6yb7[6] H DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 Replicase polyprotein 1ab
7k40[12] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
7buy[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
5reh[10] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 3C-like proteinase
6m0k[2] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
5rhd[2] H DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS2 3C-like proteinase
7k3t[2] K DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 3C-like proteinase
6xbi[1] H DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
7buy[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
7llz[10] E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1A_SARS2 Non-structural protein 3
7jrn[4] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Non-structural protein 3
7keh[6] F SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
7llz[1] G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Non-structural protein 3
6wlc[3] L SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
7k1l[6] G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
7lbr[10] J SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
3
/3
R1A_SARS2 Non-structural protein 3
7los[2] H SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
R1A_SARS2 Non-structural protein 3
7jrn[1] J SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
5
/5
R1A_SARS2 Non-structural protein 3
7lbs[1] H SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1A_SARS2 Non-structural protein 3
7jrn[1] E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS2 Non-structural protein 3
7llz[1] L SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
5
/5
R1A_SARS2 Non-structural protein 3
5wwp[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/72.3
5
/5
K0BWD0_9BETC ORF1ab
5s6x[48] E CIT
CITRIC ACID[13 atoms]
B 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[12] N CIT
CITRIC ACID[13 atoms]
A 100.0
/100.0
9
/9
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] O ACY
ACETIC ACID[4 atoms]
B 100.0
/100.0
6
/6
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] H ACY
ACETIC ACID[4 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6vww[3] P ACY
ACETIC ACID[4 atoms]
B 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] N TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[6] N TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
7llf[2] F BO3
BORIC ACID[4 atoms]
A 100.0
/100.0
7
/7
R1A_SARS2 Non-structural protein 3
7llf[2] E BO3
BORIC ACID[4 atoms]
A 100.0
/100.0
3
/3
R1A_SARS2 Non-structural protein 3
7lbs[1] O BO3
BORIC ACID[4 atoms]
B 100.0
/100.0
2
/2
R1A_SARS2 Non-structural protein 3
7lbs[1] I BO3
BORIC ACID[4 atoms]
A 100.0
/100.0
10
/10
R1A_SARS2 Non-structural protein 3
6xdh[3] F FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
8
/8
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[6] E FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6xdh[3] G FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] U FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
6wlc[3] U FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[6] Q FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
7m1y[1] O FMT
FORMIC ACID[3 atoms]
A 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7jfq[2] E FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS2 3C-like proteinase
6xdh[3] M FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 Uridylate-specific endoribonuclease
7jfq[2] C FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
6xdh[3] I FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6xkh[5] D FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
5
/5
R1AB_SARS2 3C-like proteinase
6wlc[3] V FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
1
/1
R1AB_SARS2 Uridylate-specific endoribonuclease
6wxc[3] P FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 Uridylate-specific endoribonuclease
7m1y[1] N FMT
FORMIC ACID[3 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
6xkh[2] E FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
6xkh[2] F FMT
FORMIC ACID[3 atoms]
A 85.7
/100.0
7
/7
R1AB_SARS2 3C-like proteinase
6xkh[2] G FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS2 3C-like proteinase
7m1y[1] BA FMT
FORMIC ACID[3 atoms]
B 100.0
/99.7
4
/4
R1A_SARS2 Papain-like protease
7m1y[1] M FMT
FORMIC ACID[3 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
6xez[2] Z AF3
ALUMINUM FLUORIDE[4 atoms]
F 100.0
/100.0
6
/6
R1AB_SARS2 Helicase
7kol[1] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
6
/6
R1A_SARS2 Papain-like protease
7jir[5] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/99.7
3
/3
R1A_SARS2 Papain-like protease
5nfy[2] T PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
C 100.0
/94.7
1
/1
Q1T6X8_CVHSA Polyprotein 1ab
6w01[6] AA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 100.0
/100.0
5
/5
R1AB_SARS2 Uridylate-specific endoribonuclease
6w01[3] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS2 Uridylate-specific endoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.