Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4049646 2098 500 Q9Y2I7(FYV1_HUMAN) RecName: Full=1-phosphatidylinositol 3-phosphate 5-kinase ; Short=Phosphatidylinositol 3-phosphate 5-kinase; EC=2.7.1.150 ;AltName: Full=FYVE finger-containing phosphoinositide kinase;AltName: Full=PIKfyve;AltName: Full=Phosphatidylinositol 3-phosphate 5-kinase type III; Short=PIPkin-III; Short=Type III PIP kinase;AltName: Full=Serine-protein kinase PIKFYVE; EC=2.7.11.1 ;
QUERYSEQ
MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERAEGGQGEQQPLSGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSALDTRRKAEPTFGGHDPRTAVQLRSLSTVLKRLKEIMEGKSQDSD
LKQYWMPDSQCKECYDCSEKFTTFRRRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDSACSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNTPLSTRLVSVQEDAGKSP
ARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKILLDSVQLKDLWKKICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLDCVSHHDQLFRDEYALYRPLQSTEFSETPSP
DSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENG
EKQAMERLLSANHNHMMALLQQLLHSDSLSSSWRDIIVSLVCQVVQTVRPDVKNQDDDMDIRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMSSCIKNPKILLLKCSIEYLYREETKFTCIDPIVLQEREFLKNYVQRIVDVRPTLV
LVEKTVSRIAQDMLLEHGITLVINVKSQVLERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGCTIKLRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQNPSFHSLIEGRGHEG
AVQEQYGGGSIPWDPDIPPESLPCDDSSLLELRIVFEKGEQENKNLPQAVASVKHQEHSTTACPAGLPCAFFAPVPESLLPLPVDDQQDALGSEQPETLQQTVVLQDPKSQIRAFRDPLQDDTGLYVTEEVTSSEDKRKTYSLAFKQELK
DVILCISPVITFREPFLLTEKGMRCSTRDYFAEQVYWSPLLNKEFKEMENRRKKQLLRDLSGLQGMNGSIQAKSIQVLPSHELVSTRIAEHLGDSQSLGRMLADYRARGGRIQPKNSDPFAHSKDASSTSSGQSGSKNEGDEERGLILSD
AVWSTKVDCLNPINHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLERYCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICKQVTPVVALSNESWSMSFAKYLELRFYGHQY
TRRANAEPCGHSIHHDYHQYFSYNQMVASFSYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYVAIDERLASLKTDTFSKTREEKMEDIFAQKEMEEGEFKNWIEKMQARLMSSSVDTPQQLQSVFESLIAKKQSLCEV
LQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISAMDASPRNISPGLQNGEKEDRFLTTLSSQSSTSSTHLQLPTPPEVMSEQSVGGPPELDTASSSEDVFDGHLLGSTDSQVKEKSTMKAIFANLLPGNSYNPIPFPFDPDKHY
LMYEHERVPIAVCEKEPSSIIAFALSCKEYRNALEELSKATQWNSAEEGLPTNSTSDSRPKSSSPIRLPEMSGGQTNRTTETEPQPTKKASGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTENQGVEPQDEVDGGDTQ
KKQLINPHVELQFSDANAKFYCRLYYAGEFHKMREVILDSSEEDFIRSLSHSSPWQARGGKSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVF
DLKGSLRNRNVKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHSKAVLRTSIHSDSHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGLNC
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q9Y2I7(FYV1_HUMAN)]

2098
region name description
2-2098 CHAIN /note="1-phosphatidylinositol 3-phosphate 5-kinase" /id="PRO_0000185452"
365-440 DOMAIN /note="DEP"
1758-2084 DOMAIN /note="PIPK"
158-218 ZN_FING /note="FYVE-type"
1-45 REGION /note="Disordered"
57-123 REGION /note="Disordered"
292-329 REGION /note="Disordered"
442-469 REGION /note="Disordered"
484-505 REGION /note="Disordered"
616-868 REGION /note="Chaperonin-like domain"
1161-1191 REGION /note="Disordered"
1512-1616 REGION /note="Disordered"
1692-1799 REGION /note="Disordered"
1842-2098 REGION /note="Catalytic"
1-30 COMPBIAS /note="Polar residues"
66-95 COMPBIAS /note="Polar residues"
96-118 COMPBIAS /note="Basic and acidic residues"
442-461 COMPBIAS /note="Polar residues"
1170-1186 COMPBIAS /note="Polar residues"
1559-1584 COMPBIAS /note="Polar residues"
1692-1739 COMPBIAS /note="Polar residues"
164-164 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1"
167-167 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1"
180-180 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2"
183-183 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2"
188-188 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1"
191-191 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1"
210-210 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2"
213-213 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2"
1-2098 DISORDER predicted by DISOPRED

MONOMER
2098
pdb_id a1 identity[%]2 description
7k2v B 100.0 E9PDH4_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase
7k2v A 100.0 FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase
3t7l A 43.9 ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16
1z2q A 35.7 LM5-1
2yqm A 34.5 RUFY1_HUMAN RUN and FYVE domain-containing protein 1
6vsk A 35.4 PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
2098 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7k2v[1] B E9PDH4_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase[450 aa.. A 100.0
/100.0
2
/2
FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase
7k2v[1] A FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase[264 aa.. B 100.0
/100.0
2
/2
E9PDH4_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase
4v8r[9] F TCPH_YEAST T-COMPLEX PROTEIN 1 SUBUNIT ETA[519 aa] B 0.0
/27.9
2
/2
TCPB_YEAST T-COMPLEX PROTEIN 1 SUBUNIT BETA
4v94[4] AA TCPH_YEAST T-complex protein 1 subunit eta[526 aa] CA 0.0
/27.9
1
/1
TCPB_YEAST T-complex protein 1 subunit beta
6ks6[4] K TCPH_YEAST T-complex protein 1 subunit eta[527 aa] I 0.0
/36.7
1
/1
TCPG_YEAST TCPG_YEAST fusion protein of T-complex protein 1 subunit gamm..
6ks6[2] L TCPH_YEAST T-complex protein 1 subunit eta[520 aa] P 0.0
/25.7
1
/2
TCPZ_YEAST T-complex protein 1 subunit zeta
4v81[4] F TCPZ_YEAST T-complex protein 1 subunit zeta[533 aa] B 27.3
/27.9
22
/46
TCPB_YEAST T-complex protein 1 subunit beta
4v8r[16] FA TCPZ_YEAST T-COMPLEX PROTEIN 1 SUBUNIT ZETA[531 aa] CA 39.3
/36.3
28
/62
TCPG_YEAST T-COMPLEX PROTEIN 1 SUBUNIT GAMMA
4v94[9] Y TCPZ_YEAST T-complex protein 1 subunit zeta[538 aa] AA 0.0
/27.4
1
/2
TCPH_YEAST T-complex protein 1 subunit eta
4v81[36] Y TCPA_YEAST T-complex protein 1 subunit alpha[544 aa] EA 0.0
/27.4
8
/32
TCPH_YEAST T-complex protein 1 subunit eta
4v94[4] G TCPA_YEAST T-complex protein 1 subunit alpha[539 aa] A 0.0
/25.7
1
/1
TCPZ_YEAST T-complex protein 1 subunit zeta
7pe9[2] A MTOR_HUMAN Serine/threonine-protein kinase mTOR[2194 aa] E 71.4
/35.8
7
/33
DPTOR_HUMAN DEP domain-containing mTOR-interacting protein
7nvm[1] S ACTG_HUMAN Actin, cytoplasmic 2[317 aa] E 42.9
/32.9
7
/9
TCPG_HUMAN T-complex protein 1 subunit gamma
7tub[2] A TBB5_HUMAN Tubulin beta chain[439 aa] H 0.0
/30.6
6
/15
TCPG_HUMAN T-complex protein 1 subunit gamma
4b2t[1] A TCPA_BOVIN T-COMPLEX PROTEIN 1 SUBUNIT ALPHA[481 aa] E 0.0
/30.7
1
/18
TCPG_BOVIN T-COMPLEX PROTEIN 1 SUBUNIT GAMMA
3iyg[1] G TCPA_BOVIN T-complex protein 1 subunit alpha[529 aa] C 0.0
/24.6
1
/6
TCPZ_BOVIN T-complex protein 1 subunit zeta
6nr8[12] G TCPA_HUMAN T-complex protein 1 subunit alpha[521 aa] I 22.2
/30.6
9
/24
TCPG_HUMAN T-complex protein 1 subunit gamma
6qb8[75] A TCPA_HUMAN T-complex protein 1 subunit alpha[490 aa] E 28.6
/31.1
7
/19
TCPG_HUMAN T-complex protein 1 subunit gamma
6nr8[4] A PFD1_HUMAN Prefoldin subunit 1[107 aa] I 44.4
/30.6
18
/18
TCPG_HUMAN T-complex protein 1 subunit gamma
7wu7[1] A PFD1_HUMAN Prefoldin subunit 1[107 aa] I 38.5
/30.6
13
/14
TCPG_HUMAN T-complex protein 1 subunit gamma
6nr9[3] U PFD5_HUMAN Prefoldin subunit 5[127 aa] C 100.0
/30.6
1
/1
TCPG_HUMAN T-complex protein 1 subunit gamma
7nvm[6] T PDCL3_HUMAN Phosducin-like protein 3[190 aa] N 33.3
/30.6
3
/4
TCPG_HUMAN T-complex protein 1 subunit gamma
8i6j[3] A PDCL3_HUMAN Phosducin-like protein 3[170 aa] B 41.7
/30.6
12
/19
TCPG_HUMAN T-complex protein 1 subunit gamma
7nvn[1] S TBB2A_HUMAN Tubulin beta-2A chain[307 aa] E 14.3
/30.6
7
/19
TCPG_HUMAN T-complex protein 1 subunit gamma
7trg[1] A TBB5_HUMAN Tubulin beta chain[170 aa] H 28.6
/30.6
7
/7
TCPG_HUMAN T-complex protein 1 subunit gamma
7ttn[1] A TBB5_HUMAN Tubulin beta chain[269 aa] H 14.3
/30.6
7
/13
TCPG_HUMAN T-complex protein 1 subunit gamma
7ttt[1] A TBB5_HUMAN Tubulin beta chain[351 aa] H 28.6
/30.6
7
/15
TCPG_HUMAN T-complex protein 1 subunit gamma
8ib8[1] R A0A7K5XZZ2_9CHAR ACTB protein (Fragment)[354 aa] K 0.0
/30.6
2
/2
TCPG_HUMAN T-complex protein 1 subunit gamma
8sff[5] Q PHLP_HUMAN Phosducin-like protein[205 aa] M 0.0
/30.6
1
/9
TCPG_HUMAN T-complex protein 1 subunit gamma
8shg[1] R PHLP_HUMAN Phosducin-like protein[195 aa] N 0.0
/30.6
2
/4
TCPG_HUMAN T-complex protein 1 subunit gamma
8sho[3] R PHLP_HUMAN Phosducin-like protein[183 aa] N 0.0
/30.6
2
/5
TCPG_HUMAN T-complex protein 1 subunit gamma
1a6d[16] B THSB_THEAC THERMOSOME (BETA SUBUNIT)[502 aa] A 31.8
/30.5
22
/40
THSA_THEAC THERMOSOME (ALPHA SUBUNIT)
1a6d[16] B THSB_THEAC THERMOSOME (BETA SUBUNIT)[502 aa] A 30.0
/30.5
20
/52
THSA_THEAC THERMOSOME (ALPHA SUBUNIT)
5gw4[8] I TCPG_YEAST T-complex protein 1 subunit gamma[518 aa] A 40.0
/28.0
5
/24
TCPA_YEAST T-complex protein 1 subunit alpha
4v81[4] BA TCPD_YEAST T-complex protein 1 subunit delta[522 aa] EA 20.0
/27.4
25
/46
TCPH_YEAST T-complex protein 1 subunit eta
4v8r[20] C TCPD_YEAST T-COMPLEX PROTEIN 1 SUBUNIT DELTA[515 aa] B 38.5
/27.9
39
/66
TCPB_YEAST T-COMPLEX PROTEIN 1 SUBUNIT BETA
4v81[4] Z TCPB_YEAST T-complex protein 1 subunit beta[513 aa] AA 34.8
/36.9
23
/50
TCPG_YEAST T-complex protein 1 subunit gamma
4v81[4] Z TCPB_YEAST T-complex protein 1 subunit beta[513 aa] DA 15.4
/25.9
13
/47
TCPZ_YEAST T-complex protein 1 subunit zeta
4v8r[5] Z TCPB_YEAST T-COMPLEX PROTEIN 1 SUBUNIT BETA[517 aa] DA 0.0
/27.4
1
/2
TCPH_YEAST T-COMPLEX PROTEIN 1 SUBUNIT ETA
4v81[4] CA TCPE_YEAST T-complex protein 1 subunit epsilon[525 aa] DA 22.7
/25.9
22
/47
TCPZ_YEAST T-complex protein 1 subunit zeta
4v8r[30] D TCPE_YEAST T-COMPLEX PROTEIN 1 SUBUNIT EPSILON[528 aa] B 32.0
/27.9
25
/69
TCPB_YEAST T-COMPLEX PROTEIN 1 SUBUNIT BETA
4v8r[25] BA TCPE_YEAST T-COMPLEX PROTEIN 1 SUBUNIT EPSILON[528 aa] DA 22.0
/27.4
41
/68
TCPH_YEAST T-COMPLEX PROTEIN 1 SUBUNIT ETA
3iyg[1] A TCPQ_BOVIN T-complex protein 1 subunit theta[512 aa] B 0.0
/31.3
1
/9
TCPG_BOVIN T-complex protein 1 subunit gamma
6nrb[1] H TCPQ_HUMAN T-complex protein 1 subunit theta[510 aa] G 0.0
/27.7
10
/26
TCPH_HUMAN T-complex protein 1 subunit eta
7lum[46] K TCPQ_HUMAN T-complex protein 1 subunit theta[524 aa] I 15.4
/27.7
13
/45
TCPH_HUMAN T-complex protein 1 subunit eta
7nvl[7] H TCPQ_HUMAN T-complex protein 1 subunit theta[529 aa] E 100.0
/30.6
1
/1
TCPG_HUMAN T-complex protein 1 subunit gamma
8sff[33] G TCPQ_HUMAN T-complex protein 1 subunit theta[538 aa] E 100.0
/32.9
1
/1
TCPG_HUMAN T-complex protein 1 subunit gamma
6nr8[1] D PFD4_HUMAN Prefoldin subunit 4[104 aa] M 17.6
/27.7
17
/20
TCPH_HUMAN T-complex protein 1 subunit eta
7wu7[1] D PFD4_HUMAN Prefoldin subunit 4[88 aa] M 50.0
/27.7
2
/4
TCPH_HUMAN T-complex protein 1 subunit eta
6nr8[1] H TCPB_HUMAN T-complex protein 1 subunit beta[509 aa] M 0.0
/27.7
1
/1
TCPH_HUMAN T-complex protein 1 subunit eta
7lum[14] C TCPB_HUMAN T-complex protein 1 subunit beta[518 aa] I 0.0
/27.7
2
/2
TCPH_HUMAN T-complex protein 1 subunit eta
6nr8[62] K TCPE_HUMAN T-complex protein 1 subunit epsilon[517 aa] M 6.9
/27.7
29
/63
TCPH_HUMAN T-complex protein 1 subunit eta
7lum[58] N TCPZ_HUMAN T-complex protein 1 subunit zeta[525 aa] G 36.4
/30.6
33
/55
TCPG_HUMAN T-complex protein 1 subunit gamma
7lum[43] N TCPZ_HUMAN T-complex protein 1 subunit zeta[525 aa] J 0.0
/27.7
1
/1
TCPH_HUMAN T-complex protein 1 subunit eta
7lup[1] Q SIGM3_REOVD Outer capsid protein sigma-3[365 aa] G 0.0
/30.6
4
/8
TCPG_HUMAN T-complex protein 1 subunit gamma
7lup[1] Q SIGM3_REOVD Outer capsid protein sigma-3[365 aa] J 10.0
/27.7
10
/11
TCPH_HUMAN T-complex protein 1 subunit eta
7nvl[42] E TCPG_HUMAN T-complex protein 1 subunit gamma[523 aa] F 0.0
/27.7
1
/1
TCPH_HUMAN T-complex protein 1 subunit eta
8sgl[1] Q GNB5_HUMAN Guanine nucleotide-binding protein subunit beta-5[.. F 16.7
/27.7
6
/8
TCPH_HUMAN T-complex protein 1 subunit eta, N-terminally proc..
8shd[1] A GNB5_HUMAN Guanine nucleotide-binding protein subunit beta-5[.. G 16.7
/27.7
6
/6
TCPH_HUMAN T-complex protein 1 subunit eta, N-terminally proc..
8she[3] A GNB5_HUMAN Guanine nucleotide-binding protein subunit beta-5[.. G 20.0
/27.7
5
/5
TCPH_HUMAN T-complex protein 1 subunit eta, N-terminally proc..
8shg[1] A GNB5_HUMAN Guanine nucleotide-binding protein subunit beta-5[.. G 20.0
/27.7
5
/5
TCPH_HUMAN T-complex protein 1 subunit eta, N-terminally proc..
8shl[1] A GNB5_HUMAN Guanine nucleotide-binding protein subunit beta-5[.. G 20.0
/27.7
5
/5
TCPH_HUMAN T-complex protein 1 subunit eta, N-terminally proc..
8sho[2] A GNB5_HUMAN Guanine nucleotide-binding protein subunit beta-5[.. G 14.3
/27.7
7
/7
TCPH_HUMAN T-complex protein 1 subunit eta, N-terminally proc..
8shp[2] A GNB5_HUMAN Guanine nucleotide-binding protein subunit beta-5[.. G 12.5
/27.7
8
/8
TCPH_HUMAN T-complex protein 1 subunit eta, N-terminally proc..
1a6d[16] A THSA_THEAC THERMOSOME (ALPHA SUBUNIT)[503 aa] B 27.3
/27.4
11
/32
THSB_THEAC THERMOSOME (BETA SUBUNIT)
1a6d[16] A THSA_THEAC THERMOSOME (ALPHA SUBUNIT)[503 aa] B 28.6
/27.4
35
/54
THSB_THEAC THERMOSOME (BETA SUBUNIT)
4v81[4] FA TCPQ_YEAST T-complex protein 1 subunit theta[525 aa] AA 21.4
/36.9
14
/40
TCPG_YEAST T-complex protein 1 subunit gamma
4v8r[16] EA TCPQ_YEAST T-COMPLEX PROTEIN 1 SUBUNIT THETA[523 aa] DA 17.9
/27.4
28
/65
TCPH_YEAST T-COMPLEX PROTEIN 1 SUBUNIT ETA
4v8r[31] EA TCPQ_YEAST T-COMPLEX PROTEIN 1 SUBUNIT THETA[523 aa] FA 37.5
/25.7
16
/42
TCPZ_YEAST T-COMPLEX PROTEIN 1 SUBUNIT ZETA
4v81[4] C TCPG_YEAST T-complex protein 1 subunit gamma[514 aa] B 31.2
/27.9
16
/41
TCPB_YEAST T-complex protein 1 subunit beta
4v81[4] AA TCPG_YEAST T-complex protein 1 subunit gamma[514 aa] DA 0.0
/25.9
2
/2
TCPZ_YEAST T-complex protein 1 subunit zeta
4v94[4] H TCPG_YEAST T-complex protein 1 subunit gamma[513 aa] A 29.6
/25.7
27
/62
TCPZ_YEAST T-complex protein 1 subunit zeta
4v8r[4] CA TCPG_YEAST T-COMPLEX PROTEIN 1 SUBUNIT GAMMA[509 aa] FA 32.1
/25.7
28
/64
TCPZ_YEAST T-COMPLEX PROTEIN 1 SUBUNIT ZETA
6ks6[4] I TCPG_YEAST TCPG_YEAST fusion protein of T-complex protein 1 subunit gamm.. K 0.0
/27.8
1
/1
TCPH_YEAST T-complex protein 1 subunit eta
6ks6[8] I TCPG_YEAST TCPG_YEAST fusion protein of T-complex protein 1 subunit gamm.. O 20.8
/25.7
24
/61
TCPZ_YEAST T-complex protein 1 subunit zeta
7ylw[1] H A0A6A5PXT5_YEASX Tubulin beta chain[412 aa] B 0.0
/27.9
1
/1
TCPB_YEAST T-complex protein 1 subunit beta
7ylw[1] H A0A6A5PXT5_YEASX Tubulin beta chain[412 aa] E 33.3
/36.9
12
/19
TCPG_YEAST TCPG_YEAST T-complex protein 1 subunit gamma
7ylw[1] H A0A6A5PXT5_YEASX Tubulin beta chain[412 aa] F 0.0
/27.4
1
/1
TCPH_YEAST T-complex protein 1 subunit eta
7ylw[1] H A0A6A5PXT5_YEASX Tubulin beta chain[412 aa] I 37.5
/25.7
16
/24
TCPZ_YEAST T-complex protein 1 subunit zeta
7ylw[4] P PLP2_YEAST Phosducin-like protein 2[191 aa] K 14.3
/27.9
7
/7
TCPB_YEAST T-complex protein 1 subunit beta
7ylw[8] P PLP2_YEAST Phosducin-like protein 2[191 aa] N 25.0
/36.7
4
/4
TCPG_YEAST TCPG_YEAST T-complex protein 1 subunit gamma
7ylw[2] P PLP2_YEAST Phosducin-like protein 2[191 aa] O 50.0
/27.8
2
/2
TCPH_YEAST T-complex protein 1 subunit eta
7ylx[2] O PLP2_YEAST Phosducin-like protein 2[191 aa] N 0.0
/27.8
3
/3
TCPH_YEAST T-complex protein 1 subunit eta
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
2098 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1hyi[1] D ITP
PHOSPHORIC ACID MONO-(2,3,4,6-TETRAHYDROXY-5-PHOSP..
A 100.0
/45.9
4
/5
EEA1_HUMAN ENDOSOME-ASSOCIATED PROTEIN
1joc[2] E ITP
PHOSPHORIC ACID MONO-(2,3,4,6-TETRAHYDROXY-5-PHOSP..
A 100.0
/43.9
7
/8
EEA1_HUMAN Early Endosomal Autoantigen 1
4avx[1] E ITP
PHOSPHORIC ACID MONO-(2,3,4,6-TETRAHYDROXY-5-PHOSP..
A 83.3
/38.5
6
/7
HGS_HUMAN HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE..
3j1f[18] S ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
A 16.7
/26.4
6
/18
Q877H2_9CREN Chaperonin beta subunit
6cmw[2] B ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
A 71.4
/33.0
14
/17
Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase, type I,..
6ux9[2] C UHJ
N-[4-(5-{(Z)-[(2E)-2-imino-4-oxo-1,3-thiazolidin-5..
A 46.2
/32.1
13
/17
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
6ym4[2] C P4Z
(2~{R})-2-[[2-[4-(3-chloranyl-2-fluoranyl-phenyl)p..
A 40.0
/32.1
15
/17
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
8c8c[2] B U1U
~{N}-(3-chloranyl-4-methoxy-phenyl)-7-(3,4-dimethy..
A 46.2
/31.8
13
/14
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
7n7n[2] B IBI
N-{trans-4-[4-(cyclopropylmethyl)piperazin-1-yl]cy..
A 46.2
/31.7
13
/15
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
6osp[2] C N51
4-{[(2E)-4-(dimethylamino)but-2-enoyl]amino}-N-(3-..
A 54.5
/31.1
11
/12
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
6ym3[2] C OYZ
(2~{R})-2-[[3-cyano-2-[4-(2-ethoxyphenyl)phenyl]-5..
A 46.2
/31.5
13
/15
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
6ym5[2] D OZ5
(2~{R})-2-[[3-cyano-2-[4-(2-fluoranyl-3-methyl-phe..
A 42.9
/32.1
14
/16
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
7n7l[2] B 584
(7R)-2-[(3,5-difluoro-4-hydroxyphenyl)amino]-5,7-d..
A 54.5
/31.5
11
/14
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
7n7m[2] B R78
4-{[(7R)-8-cyclopentyl-7-ethyl-5-methyl-6-oxo-5,6,..
A 54.5
/31.1
11
/13
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
1a6e[56] G ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
B 50.0
/27.4
2
/22
THSB_THEAC THERMOSOME (BETA SUBUNIT)
3ko1[18] J ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 16.7
/26.4
6
/17
Q877H2_9CREN Chaperonin
4v81[18] SA ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
G 0.0
/27.4
1
/13
TCPH_YEAST T-complex protein 1 subunit eta
7n7o[2] B LQQ
6-ACETYL-8-CYCLOPENTYL-5-METHYL-2-[(5-PIPERAZIN-1-..
A 46.2
/30.5
13
/15
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
5e3t[4] B ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 83.3
/36.3
12
/15
Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase, type I,..
7n7j[4] D ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 58.3
/31.9
12
/13
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
7qpn[2] D ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 16.7
/29.8
6
/10
Phosphatidylinositol 5-Phosphate 4-Kinase (PI5P4K2..
7qie[3] E DVF
5-methyl-2-(2-propan-2-ylphenyl)-~{N}-(pyridin-2-y..
A 36.4
/29.8
11
/16
PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 g..
7qie[1] F DVF
5-methyl-2-(2-propan-2-ylphenyl)-~{N}-(pyridin-2-y..
B 53.8
/30.4
13
/13
PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 g..
7qpn[2] C DVF
5-methyl-2-(2-propan-2-ylphenyl)-~{N}-(pyridin-2-y..
A 40.0
/29.8
10
/15
Phosphatidylinositol 5-Phosphate 4-Kinase (PI5P4K2..
8bq4[2] C QZR
6-methyl-~{N}-(4-methylsulfonylphenyl)thieno[2,3-d..
A 53.8
/29.9
13
/17
PI42C_HUMAN PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 g..
7n81[1] C HKP
(7R)-8-cyclopentyl-7-(cyclopentylmethyl)-2-[(3,5-d..
B 28.6
/30.1
14
/17
PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 b..
3x06[2] C 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
A 55.6
/29.4
9
/10
PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 b..
3x06[2] E 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
A 0.0
/29.4
2
/3
PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 b..
3x05[1] C AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 50.0
/29.3
8
/10
PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 b..
3x05[1] D AMP
ADENOSINE MONOPHOSPHATE[23 atoms]
A 37.5
/29.3
8
/8
PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 b..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
2098 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1dvp[4] B ZN
ZINC ION[1 atoms]
A 100.0
/40.0
4
/4
HRS_DROME HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE..
1dvp[4] C ZN
ZINC ION[1 atoms]
A 100.0
/40.0
4
/4
HRS_DROME HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE..
1hyi[4] B ZN
ZINC ION[1 atoms]
A 100.0
/45.9
4
/4
EEA1_HUMAN ENDOSOME-ASSOCIATED PROTEIN
1hyi[2] C ZN
ZINC ION[1 atoms]
A 100.0
/45.9
2
/4
EEA1_HUMAN ENDOSOME-ASSOCIATED PROTEIN
1joc[2] C ZN
ZINC ION[1 atoms]
A 100.0
/43.9
2
/4
EEA1_HUMAN Early Endosomal Autoantigen 1
1joc[2] D ZN
ZINC ION[1 atoms]
A 100.0
/43.9
4
/4
EEA1_HUMAN Early Endosomal Autoantigen 1
1x4u[3] B ZN
ZINC ION[1 atoms]
A 100.0
/38.8
4
/4
Q5T4F4_HUMAN Zinc finger, FYVE domain containing 27 isoform b
2yqm[1] B ZN
ZINC ION[1 atoms]
A 100.0
/34.5
4
/4
RUFY1_HUMAN RUN and FYVE domain-containing protein 1
2yqm[1] C ZN
ZINC ION[1 atoms]
A 100.0
/34.5
4
/4
RUFY1_HUMAN RUN and FYVE domain-containing protein 1
3t7l[1] C ZN
ZINC ION[1 atoms]
A 100.0
/43.9
4
/4
ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16
5e3t[8] C MN
MANGANESE (II) ION[1 atoms]
A 100.0
/36.3
1
/2
Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase, type I,..
7n7j[4] C MN
MANGANESE (II) ION[1 atoms]
A 100.0
/31.9
1
/2
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
1gn1[3] I CA
CALCIUM ION[1 atoms]
F 50.0
/32.2
2
/2
TCPG_MOUSE CCT-GAMMA
6cmw[4] C CA
CALCIUM ION[1 atoms]
A 100.0
/33.0
3
/4
Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase, type I,..
1ass[2] B NA
SODIUM ION[1 atoms]
A 20.0
/32.2
5
/5
THSA_THEAC THERMOSOME
1a6e[15] F MG
MAGNESIUM ION[1 atoms]
B 0.0
/27.4
1
/2
THSB_THEAC THERMOSOME (BETA SUBUNIT)
3j1f[17] T MG
MAGNESIUM ION[1 atoms]
A 100.0
/26.4
1
/1
Q877H2_9CREN Chaperonin beta subunit
4v8r[9] RD MG
MAGNESIUM ION[1 atoms]
DA 50.0
/27.4
2
/3
TCPH_YEAST T-COMPLEX PROTEIN 1 SUBUNIT ETA
4v8r[26] DB MG
MAGNESIUM ION[1 atoms]
H 0.0
/25.7
2
/3
TCPZ_YEAST T-COMPLEX PROTEIN 1 SUBUNIT ZETA
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
2098 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1joc[2] B EEA1_HUMAN Early Endosomal Autoantigen 1[123 aa] A 66.7
/43.9
9
/41
EEA1_HUMAN Early Endosomal Autoantigen 1
1dvp[2] A HRS_DROME HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE.. A 55.6
/40.0
9
/19
HRS_DROME HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE..
7ped[2] B DPTOR_HUMAN DEP domain-containing mTOR-interacting protein[211.. A 37.8
/36.4
37
/49
DPTOR_HUMAN DEP domain-containing mTOR-interacting protein
6vsk[6] A PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent.. A 0.0
/35.4
2
/5
PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent..
6vsk[6] A PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent.. A 50.0
/35.4
2
/8
PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent..
6vsk[6] A PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent.. A 38.1
/35.4
21
/28
PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent..
6vsk[6] A PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent.. A 35.1
/35.4
37
/40
PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent..
4tz7[4] A Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase, type I,.. A 44.4
/36.3
9
/17
Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase, type I,..
5e3s[6] A Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase, type I,.. A 50.0
/36.3
8
/16
Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase, type I,..
1ass[4] A THSA_THEAC THERMOSOME[152 aa] A 23.5
/32.2
17
/23
THSA_THEAC THERMOSOME
1gml[12] D TCPG_MOUSE T-COMPLEX PROTEIN 1 SUBUNIT GAMMA[149 aa] A 31.2
/33.1
16
/16
TCPG_MOUSE T-COMPLEX PROTEIN 1 SUBUNIT GAMMA
7n81[1] A PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 b.. B 0.0
/30.1
2
/26
PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 b..
1bo1[4] A PI52B_HUMAN PROTEIN (PHOSPHATIDYLINOSITOL PHOSPHATE KINASE IIB.. B 0.0
/28.6
2
/25
PI52B_HUMAN PROTEIN (PHOSPHATIDYLINOSITOL PHOSPHATE KINASE IIB..
1q2v[64] B THSA_PYRKOX Thermosome alpha subunit[518 aa] A 25.0
/27.9
36
/68
THSA_PYRKOX Thermosome alpha subunit
1q2v[64] B THSA_PYRKOX Thermosome alpha subunit[518 aa] A 23.8
/27.9
21
/57
THSA_PYRKOX Thermosome alpha subunit
1q2v[32] B THSA_PYRKOX Thermosome alpha subunit[518 aa] B 100.0
/27.9
1
/1
THSA_PYRKOX Thermosome alpha subunit
1a6d[16] B THSB_THEAC THERMOSOME (BETA SUBUNIT)[502 aa] B 0.0
/27.4
1
/1
THSB_THEAC THERMOSOME (BETA SUBUNIT)
1a6e[8] B THSB_THEAC THERMOSOME (BETA SUBUNIT)[502 aa] B 0.0
/27.4
1
/2
THSB_THEAC THERMOSOME (BETA SUBUNIT)
3j1b[34] B Q877H0_9CREN Chaperonin alpha subunit[519 aa] A 20.0
/27.0
5
/18
Q877H0_9CREN Chaperonin alpha subunit
3j1b[34] H Q877H0_9CREN Chaperonin alpha subunit[519 aa] A 0.0
/27.0
2
/18
Q877H0_9CREN Chaperonin alpha subunit
3j1e[54] B Q877H2_9CREN Chaperonin beta subunit[505 aa] A 33.3
/26.4
6
/14
Q877H2_9CREN Chaperonin beta subunit
3j1e[8] K Q877H2_9CREN Chaperonin beta subunit[505 aa] B 0.0
/26.4
1
/9
Q877H2_9CREN Chaperonin beta subunit
3ko1[18] B Q877H2_9CREN Chaperonin[505 aa] A 16.7
/26.4
6
/7
Q877H2_9CREN Chaperonin
3ko1[18] C Q877H2_9CREN Chaperonin[505 aa] A 55.6
/26.4
9
/11
Q877H2_9CREN Chaperonin
5w79[8] B Q877G8_METMI Chaperonin[515 aa] A 23.5
/25.0
17
/49
Q877G8_METMI Chaperonin
5w79[8] H Q877G8_METMI Chaperonin[515 aa] A 11.1
/25.0
18
/50
Q877G8_METMI Chaperonin
5w79[2] H Q877G8_METMI Chaperonin[515 aa] F 100.0
/25.0
1
/1
Q877G8_METMI Chaperonin
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
2098 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1dvp[2] D CIT
CITRIC ACID[13 atoms]
A 100.0
/40.0
5
/5
HRS_DROME HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE..
1dvp[2] D CIT
CITRIC ACID[13 atoms]
A 50.0
/40.0
2
/3
HRS_DROME HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE..
3t7l[1] D EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/43.9
3
/3
ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16
3zyq[1] F EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/38.5
4
/4
HGS_HUMAN HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE..
4avx[1] B EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/38.5
3
/5
HGS_HUMAN HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE..
4avx[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/38.5
3
/3
HGS_HUMAN HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE..
5e3u[2] E SE4
SELENATE ION[5 atoms]
A 66.7
/36.3
3
/3
Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase, type I,..
5e3u[2] F SE4
SELENATE ION[5 atoms]
A 0.0
/36.3
2
/2
Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase, type I,..
1gml[4] E GOL
GLYCEROL[6 atoms]
A 25.0
/33.1
4
/4
TCPG_MOUSE T-COMPLEX PROTEIN 1 SUBUNIT GAMMA
1gml[2] H GOL
GLYCEROL[6 atoms]
A 100.0
/33.1
2
/2
TCPG_MOUSE T-COMPLEX PROTEIN 1 SUBUNIT GAMMA
1gml[2] F GOL
GLYCEROL[6 atoms]
C 0.0
/33.1
1
/1
TCPG_MOUSE T-COMPLEX PROTEIN 1 SUBUNIT GAMMA
6osp[3] D GOL
GLYCEROL[6 atoms]
A 16.7
/31.1
6
/7
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
6ym4[2] D GOL
GLYCEROL[6 atoms]
A 25.0
/32.1
4
/6
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
1ass[2] C PO4
PHOSPHATE ION[5 atoms]
A 40.0
/32.2
5
/5
THSA_THEAC THERMOSOME
1ass[6] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/32.2
1
/1
THSA_THEAC THERMOSOME
1ass[4] D PO4
PHOSPHATE ION[5 atoms]
A 0.0
/32.2
2
/2
THSA_THEAC THERMOSOME
1ass[2] E PO4
PHOSPHATE ION[5 atoms]
A 33.3
/32.2
3
/3
THSA_THEAC THERMOSOME
2ybx[1] C PO4
PHOSPHATE ION[5 atoms]
A 75.0
/32.1
4
/5
PI42A_HUMAN PHOSPHATIDYLINOSITOL-5-PHOSPHATE 4-KINASE TYPE-2 A..
6ym3[2] F PO4
PHOSPHATE ION[5 atoms]
B 100.0
/31.7
1
/3
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
1a6e[44] H AF3
ALUMINUM FLUORIDE[4 atoms]
B 0.0
/27.4
1
/9
THSB_THEAC THERMOSOME (BETA SUBUNIT)
6ks6[8] WA AF3
ALUMINUM FLUORIDE[4 atoms]
K 0.0
/27.8
1
/6
TCPH_YEAST T-complex protein 1 subunit eta
3zyq[1] D SO4
SULFATE ION[5 atoms]
A 100.0
/38.5
4
/4
HGS_HUMAN HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE..
7n6z[16] B SO4
SULFATE ION[5 atoms]
A 100.0
/31.9
2
/2
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
7n6z[16] C SO4
SULFATE ION[5 atoms]
A 100.0
/31.9
1
/3
PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 a..
4v81[9] GC BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
DA 0.0
/25.9
1
/3
TCPZ_YEAST T-complex protein 1 subunit zeta
4v81[10] TA BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
G 0.0
/27.4
1
/6
TCPH_YEAST T-complex protein 1 subunit eta
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.