Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1687236 765 10 Q9ULC8(ZDHC8_HUMAN) RecName: Full=Palmitoyltransferase ZDHHC8 ; EC=2.3.1.225 ;AltName: Full=Zinc finger DHHC domain-containing protein 8 ; Short=DHHC-8 ;AltName: Full=Zinc finger protein 378;
QUERYSEQ 
MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLANFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFF
LFLLSLSAHMVGVVAFGLVYVLNHAEGLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKFRGGVNPFTRGCCGNVEHVLCSPLAPRYVVEPPRLPLAVSLKPPFLRPELLDRAAPLKVKLSDNGLKAGLGRSKSK
GSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPPTPAMYKFRPAFPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPLSASDAFSGALRSLSLKASSRRGGDHVALQP
LRSEGGPPTPHRSIFAPHALPNRNGSLSYDSLLNPGSPGGHACPAHPAVGVAGYHSPYLHPGATGDPPRPLPRSFSPVLGPRPREPSPVRYDNLSRTIMASIQERKDREERERLLRSQADSLFGDSGVYDAPSSYSLQQASVLSEGPRGP
ALRYGSRDDLVAGPGFGGARNPALQTSLSSLSSSVSRAPRTSSSSLQADQASSNAPGPRPSSGSHRSPARQGLPSPPGTPHSPSYAGPKAVAFIHTDLPEPPPSLTVQRDHPQLKTPPSKLNGQSPGLARLGPATGPPGPSASPTRHTLV
KKVSGVGGTTYEISV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q9ULC8(ZDHC8_HUMAN)]

765
region name description
1-765 CHAIN /note="Palmitoyltransferase ZDHHC8" /id="PRO_0000212877"
1-13 TOPO_DOM /note="Cytoplasmic"
14-34 TRANSMEM /note="Helical"
35-52 TOPO_DOM /note="Lumenal"
53-73 TRANSMEM /note="Helical"
74-148 TOPO_DOM /note="Cytoplasmic"
149-169 TRANSMEM /note="Helical"
170-190 TOPO_DOM /note="Lumenal"
191-211 TRANSMEM /note="Helical"
212-765 TOPO_DOM /note="Cytoplasmic"
104-154 DOMAIN /note="DHHC"
293-352 REGION /note="Disordered"
509-540 REGION /note="Disordered"
613-747 REGION /note="Disordered"
325-350 COMPBIAS /note="Polar residues"
513-534 COMPBIAS /note="Pro residues"
622-669 COMPBIAS /note="Polar residues"
709-723 COMPBIAS /note="Polar residues"
134-134 ACT_SITE /note="S-palmitoyl cysteine intermediate"
1-765 DISORDER predicted by DISOPRED

MONOMER
765
pdb_id a1 identity[%]2 description
6bms B 39.8 F1QXD3_DANRE Palmitoyltransferase
6bmn A 33.3 ZDH20_HUMAN human DHHC20 palmitoyltransferase 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
COMPOUND
765 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6bms[1] I POV
(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoylox.. 		A 20.0
/39.8		 5
/8		 F1QXD3_DANRE Palmitoyltransferase
6bml[2] J PAP
3'-PHOSPHATE-ADENOSINE-5'-DIPHOSPHATE[31 atoms] 		B 40.0
/32.9		 5
/6		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[1] I DYD
(2S,5S)-hexane-2,5-diol[8 atoms] 		A 0.0
/32.5		 1
/1		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[1] J DYD
(2S,5S)-hexane-2,5-diol[8 atoms] 		A 0.0
/32.5		 2
/4		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[1] K DYD
(2S,5S)-hexane-2,5-diol[8 atoms] 		A 0.0
/32.5		 2
/2		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[1] P DYD
(2S,5S)-hexane-2,5-diol[8 atoms] 		B 0.0
/32.5		 2
/6		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
7khm[2] E PKZ
Palmitoyl-CoA[65 atoms] 		A 60.0
/32.3		 15
/16		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
7khm[1] E PKZ
Palmitoyl-CoA[65 atoms] 		B 33.3
/32.3		 6
/6		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
765 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6bml[4] C ZN
ZINC ION[1 atoms] 		A 100.0
/32.9		 4
/4		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bml[4] D ZN
ZINC ION[1 atoms] 		A 100.0
/32.9		 4
/4		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[2] C ZN
ZINC ION[1 atoms] 		A 100.0
/32.5		 4
/4		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[2] D ZN
ZINC ION[1 atoms] 		A 80.0
/32.5		 5
/5		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bms[2] C ZN
ZINC ION[1 atoms] 		A 80.0
/39.8		 5
/5		 F1QXD3_DANRE Palmitoyltransferase
6bms[2] D ZN
ZINC ION[1 atoms] 		A 100.0
/39.8		 4
/4		 F1QXD3_DANRE Palmitoyltransferase
7khm[2] C ZN
ZINC ION[1 atoms] 		A 100.0
/32.3		 4
/4		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
7khm[2] D ZN
ZINC ION[1 atoms] 		A 100.0
/32.3		 4
/4		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
765 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6bmm[2] B ZDH20_HUMAN human DHHC20 palmitoyltransferase[290 aa] A 100.0
/32.5		 1
/2		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
7khm[1] B ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20[287 aa] A 0.0
/32.3		 5
/7		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
7khm[1] A ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20[290 aa] B 16.7
/32.3		 6
/7		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
765 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6bml[2] E PLM
PALMITIC ACID[18 atoms] 		A 80.0
/32.9		 10
/13		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bms[2] H PLM
PALMITIC ACID[18 atoms] 		A 57.1
/39.8		 14
/17		 F1QXD3_DANRE Palmitoyltransferase
6bms[1] E LMT
DODECYL-BETA-D-MALTOSIDE[31 atoms] 		A 50.0
/39.8		 4
/5		 F1QXD3_DANRE Palmitoyltransferase
6bms[3] F LMT
DODECYL-BETA-D-MALTOSIDE[28 atoms] 		A 25.0
/39.8		 4
/4		 F1QXD3_DANRE Palmitoyltransferase
6bmm[2] F OLB
(2S)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate[25 .. 		A 58.3
/32.5		 12
/13		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bml[5] F PO4
PHOSPHATE ION[5 atoms] 		A 33.3
/32.9		 3
/3		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[5] E PO4
PHOSPHATE ION[5 atoms] 		A 33.3
/32.5		 3
/3		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
7khm[1] F PO4
PHOSPHATE ION[5 atoms] 		A 0.0
/32.3		 3
/3		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.