Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
883292 186 500 Q9NVJ2(ARL8B_HUMAN) RecName: Full=ADP-ribosylation factor-like protein 8B ; EC=3.6.5.2 ;AltName: Full=ADP-ribosylation factor-like protein 10C;AltName: Full=Novel small G protein indispensable for equal chromosome segregation 1;
QUERYSEQ
MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLS
AIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q9NVJ2(ARL8B_HUMAN)]

186
region name description
1-186 CHAIN /note="ADP-ribosylation factor-like protein 8B" /id="PRO_0000232921"
29-35 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565"
71-75 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565"
130-133 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565"
1-186 DISORDER predicted by DISOPRED

MONOMER
186
pdb_id a1 identity[%]2 description
4ile A 92.6 ARL8A_HUMAN ADP-ribosylation factor-like protein 8A
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
186 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8f6d[4] A CNNM2_HUMAN Metal transporter CNNM2[153 aa] B 33.3
/40.4
9
/9
ARL15_HUMAN ADP-ribosylation factor-like protein 15
1tu3[5] F RABE1_HUMAN Rab GTPase binding effector protein 1[46 aa] A 42.9
/36.3
7
/9
RAB5A_HUMAN Ras-related protein Rab-5A
1tu3[5] G RABE1_HUMAN Rab GTPase binding effector protein 1[51 aa] A 50.0
/36.3
6
/6
RAB5A_HUMAN Ras-related protein Rab-5A
3pcr[3] A Q7DB50_ECO57 EspG[349 aa] B 38.5
/35.9
13
/13
ARF6_HUMAN ADP-ribosylation factor 6
4fmc[6] A O52121_ECOLX ROrf2[351 aa] B 52.0
/33.0
25
/27
RAB1A_HUMAN Ras-related protein Rab-1A
2w83[4] C JIP4_HUMAN C-JUN-AMINO-TERMINAL KINASE-INTERACTING PROTEIN 4[.. A 57.1
/35.7
7
/7
ARF6_HUMAN ADP-RIBOSYLATION FACTOR 6
3vhx[4] B KIF23_HUMAN Kinesin-like protein KIF23[106 aa] A 37.5
/35.7
24
/24
ARF6_MOUSE ADP-ribosylation factor 6
3vhx[4] D KIF23_HUMAN Kinesin-like protein KIF23[106 aa] A 50.0
/35.7
2
/2
ARF6_MOUSE ADP-ribosylation factor 6
2a5d[3] B CHTA_VIBCH Cholera enterotoxin, A chain[187 aa] A 40.9
/35.6
22
/22
ARF6_HUMAN ADP-ribosylation factor 6
7bl1[1] B PK3C3_HUMAN Phosphatidylinositol 3-kinase catalytic subunit ty.. F 60.0
/35.4
5
/5
RAB5A_HUMAN Ras-related protein Rab-5A
7bl1[1] C PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4[118.. F 100.0
/35.4
1
/3
RAB5A_HUMAN Ras-related protein Rab-5A
4kax[1] B CYH3_HUMAN Cytohesin-3[143 aa] A 31.8
/35.3
22
/22
ARF6_HUMAN ADP-ribosylation factor 6
6vbv[1] B E1BN34_BOVIN BBS1 domain-containing protein[486 aa] I 25.0
/35.0
12
/12
ARL6_BOVIN ADP-ribosylation factor-like protein 6
6vbv[1] F F1MB52_BOVIN Bardet-Biedl syndrome 7 protein homolog[706 aa] I 30.0
/35.0
10
/13
ARL6_BOVIN ADP-ribosylation factor-like protein 6
6voa[1] E F1MB52_BOVIN Bardet-Biedl syndrome 7 protein homolog[667 aa] H 33.3
/35.0
6
/6
ARL6_BOVIN ADP-ribosylation factor-like protein 6
6voa[1] I E1BN34_BOVIN BBS1 domain-containing protein[528 aa] H 16.7
/35.0
6
/6
ARL6_BOVIN ADP-ribosylation factor-like protein 6
3bh6[2] B XRP2_HUMAN Protein XRP2[314 aa] A 22.7
/33.8
22
/22
ARL3_MOUSE ADP-ribosylation factor-like protein 3
4zi2[4] C CFA36_MOUSE Cilia- and flagella-associated protein 36[131 aa] A 50.0
/33.1
12
/19
ARL3_MOUSE ADP-ribosylation factor-like protein 3
4zi3[2] D CFA36_MOUSE Cilia- and flagella-associated protein 36[128 aa] A 0.0
/33.1
3
/3
ARL3_MOUSE ADP-ribosylation factor-like protein 3
7ok7[4] I U119B_HUMAN Protein unc-119 homolog B[171 aa] A 42.1
/34.2
19
/20
ARL3_MOUSE ADP-ribosylation factor-like protein 3
6x90[1] A SEC12_YEAST Guanine nucleotide-exchange factor SEC12[344 aa] B 36.4
/34.1
22
/22
SAR1_YEAST Small COPII coat GTPase SAR1
4q66[1] B W7PD87_YEASX Chs5p[158 aa] J 25.0
/33.8
4
/4
ARF1_YEAST ADP-ribosylation factor 1
4q66[1] E BCH1_YEAST Protein BCH1[593 aa] J 28.6
/33.8
7
/7
ARF1_YEAST ADP-ribosylation factor 1
4q66[1] A W7PD87_YEASX Chs5p[226 aa] K 54.5
/33.6
11
/11
ARF1_YEAST ADP-ribosylation factor 1
4q66[1] G BCH1_YEAST Protein BCH1[507 aa] K 33.3
/33.6
6
/6
ARF1_YEAST ADP-ribosylation factor 1
3sfv[1] B A5IFX1_LEGPC LidA protein, substrate of the Dot/Icm system[342 .. A 41.9
/33.3
31
/40
RAB1A_HUMAN Ras-related protein Rab-1A
7uro[2] A A0A8H8ULJ2_YEASX GEA2 isoform 1[1160 aa] B 68.0
/33.1
25
/25
A0A6A5Q0M1_YEASX ARF1 isoform 1
3l0i[1] C Q29ST3_LEGPN DrrA[322 aa] D 50.0
/33.0
30
/38
RAB1A_HUMAN Ras-related protein Rab-1A
3tkl[1] B A5IFX1_LEGPC LidA protein, substrate of the Dot/Icm system[192 .. A 46.7
/33.0
15
/18
RAB1A_HUMAN Ras-related protein Rab-1A
4fmb[6] A VIRA_SHIFL Cysteine protease-like virA[351 aa] B 52.0
/33.0
25
/28
RAB1A_HUMAN Ras-related protein Rab-1A
4i1o[4] D Q5ZSM7_LEGPH LepB[281 aa] A 56.2
/28.9
16
/19
RAB1B_HUMAN Ras-related protein Rab-1B
4iru[3] A Q5ZSM7_LEGPH LepB[296 aa] B 54.5
/33.0
22
/25
RAB1A_HUMAN Ras-related protein Rab-1A
4jvs[1] A G9EPL4_9GAMM Putative uncharacterized protein[279 aa] B 50.0
/33.0
20
/23
RAB1A_HUMAN Ras-related protein Rab-1A
5szh[2] A MICLK_HUMAN MICAL C-terminal-like protein[143 aa] B 41.7
/28.9
12
/22
RAB1B_HUMAN Ras-related protein Rab-1B
4q66[1] D W7PD87_YEASX Chs5p[171 aa] I 40.0
/32.9
15
/15
ARF1_YEAST ADP-ribosylation factor 1
4q66[1] F BCH1_YEAST Protein BCH1[557 aa] I 28.6
/32.9
7
/7
ARF1_YEAST ADP-ribosylation factor 1
5di3[1] B ARL3_CHLRE ADP-ribosylation factor-like protein 3[164 aa] A 43.8
/32.8
16
/19
ARL13_CHLRE ADP-ribosylation factor-like protein 13B
3tjz[2] B COPG_BOVIN Coatomer subunit gamma[264 aa] A 50.0
/32.7
18
/18
ARF1_YEAST ADP-ribosylation factor 1
5a1u[5] D COPB2_MOUSE COATOMER SUBUNIT BETA' [803 aa] A 33.3
/32.7
3
/3
ARF1_YEAST ADP-RIBOSYLATION FACTOR 1
5a1y[1] D COPB2_MOUSE COATOMER SUBUNIT BETA' [803 aa] J 0.0
/32.7
3
/3
ARF1_YEAST ADP-RIBOSYLATION FACTOR 1
5a1u[9] E COPG1_MOUSE COATOMER SUBUNIT GAMMA-1[824 aa] A 50.0
/32.7
2
/2
ARF1_YEAST ADP-RIBOSYLATION FACTOR 1
5nzr[5] F COPG1_MOUSE Coatomer subunit gamma-1[798 aa] G 66.7
/32.7
3
/3
ARF1_YEAST ADP-ribosylation factor 1
5a1w[5] E COPG1_MOUSE COATOMER SUBUNIT GAMMA-1[550 aa] A 50.0
/32.7
2
/2
ARF1_YEAST ADP-RIBOSYLATION FACTOR 1
5nzr[5] D COPD_MOUSE Coatomer subunit delta[177 aa] E 0.0
/32.7
2
/2
ARF1_YEAST ADP-ribosylation factor 1
5nzr[6] I COPG1_MOUSE Coatomer subunit gamma-1[560 aa] K 50.0
/32.7
2
/2
ARF1_YEAST ADP-ribosylation factor 1
5nzu[2] D COPD_MOUSE Coatomer subunit delta[427 aa] E 0.0
/32.7
2
/2
ARF1_YEAST ADP-ribosylation factor 1
1r8q[3] B CYH2_HUMAN Arno[191 aa] A 60.0
/33.3
20
/20
ARF1_BOVIN ADP-ribosylation factor 1
1r8q[1] D CYH2_HUMAN Arno[194 aa] A 16.7
/33.3
6
/6
ARF1_BOVIN ADP-ribosylation factor 1
1r8q[2] D CYH2_HUMAN Arno[194 aa] C 0.0
/33.3
2
/2
ARF1_BOVIN ADP-ribosylation factor 1
1r8s[3] B CYH2_HUMAN Arno[187 aa] A 42.9
/32.1
28
/28
ARF1_BOVIN ADP-ribosylation factor 1
1r8s[2] B CYH2_HUMAN Arno[187 aa] A 28.6
/32.1
14
/15
ARF1_BOVIN ADP-ribosylation factor 1
7mge[1] B SMCR8_HUMAN Guanine nucleotide exchange protein SMCR8[442 aa] D 42.9
/32.5
7
/7
ARF1_HUMAN ADP-ribosylation factor 1
7mge[1] C CI072_HUMAN Guanine nucleotide exchange C9orf72[365 aa] D 60.0
/32.5
5
/5
ARF1_HUMAN ADP-ribosylation factor 1
2wwx[4] B Q29ST3_LEGPN DRRA[200 aa] A 50.0
/32.2
30
/36
RAB1A_HUMAN RAS-RELATED PROTEIN RAB-1
4c0a[4] F IQEC1_HUMAN IQ MOTIF AND SEC7 DOMAIN-CONTAINING PROTEIN 1[351 .. C 43.8
/32.1
32
/32
ARF1_BOVIN ADP-RIBOSYLATION FACTOR 1
5di3[1] A ARL13_CHLRE ADP-ribosylation factor-like protein 13B[204 aa] B 11.1
/32.1
18
/18
ARL3_CHLRE ADP-ribosylation factor-like protein 3
6ii6[2] A Putative RTX-toxin[349 aa] C 27.3
/32.1
22
/22
ARF3_HUMAN ADP-ribosylation factor 3
1re0[1] B GEA1_YEAST ARF guanine-nucleotide exchange factor 1[195 aa] A 45.5
/32.1
22
/22
ARF1_HUMAN ADP-ribosylation factor 1
7dn8[8] A Q8ZPY9_SALTY Putative cytoplasmic protein[292 aa] B 35.0
/31.4
20
/20
ARF1_HUMAN ADP-ribosylation factor 1
4hmy[1] B AP1B1_HUMAN AP-1 complex subunit beta-1[563 aa] E 46.7
/30.3
15
/15
ARF1_HUMAN ADP-ribosylation factor 1
6cm9[5] C AP1B1_HUMAN AP-1 complex subunit beta-1[570 aa] D 41.2
/30.3
17
/17
ARF1_HUMAN ADP-ribosylation factor 1
6cri[4] B AP1B1_HUMAN AP-1 complex subunit beta-1[570 aa] C 43.8
/30.3
16
/16
ARF1_HUMAN ADP-ribosylation factor 1
8d4c[5] E AP1B1_HUMAN AP-1 complex subunit beta-1[570 aa] A 100.0
/31.8
1
/1
ARF1_HUMAN ADP-ribosylation factor 1
6cm9[5] E AP1G1_MOUSE AP-1 complex subunit gamma-1[585 aa] F 46.7
/31.8
15
/15
ARF1_HUMAN ADP-ribosylation factor 1
6cri[4] D AP1G1_MOUSE AP-1 complex subunit gamma-1[585 aa] E 53.8
/31.8
13
/13
ARF1_HUMAN ADP-ribosylation factor 1
6d84[2] M AP1G1_MOUSE AP-1 complex subunit gamma-1[585 aa] D 20.0
/30.3
5
/5
ARF1_HUMAN ADP-ribosylation factor 1
7ux3[36] F AP1G1_MOUSE AP-1 complex subunit gamma-1[585 aa] B 100.0
/31.8
1
/1
ARF1_HUMAN ADP-ribosylation factor 1
8d9r[6] Z AP1G1_MOUSE AP-1 complex subunit gamma-1[585 aa] J 0.0
/31.8
3
/3
ARF1_HUMAN ADP-ribosylation factor 1
6cm9[5] G AP1M1_MOUSE AP-1 complex subunit mu-1[415 aa] F 0.0
/31.8
6
/6
ARF1_HUMAN ADP-ribosylation factor 1
6cri[4] F AP1M1_MOUSE AP-1 complex subunit mu-1[415 aa] E 0.0
/31.8
6
/6
ARF1_HUMAN ADP-ribosylation factor 1
8d4e[17] H AP1M1_MOUSE AP-1 complex subunit mu-1[415 aa] J 33.3
/31.8
3
/3
ARF1_HUMAN ADP-ribosylation factor 1
8d9w[1] D AP1M1_MOUSE AP-1 complex subunit mu-1[301 aa] E 0.0
/31.8
2
/2
ARF1_HUMAN ADP-ribosylation factor 1
8d9w[1] T AP1M1_MOUSE AP-1 complex subunit mu-1[322 aa] K 0.0
/31.8
3
/3
ARF1_HUMAN ADP-ribosylation factor 1
1r4a[4] B GOGA4_HUMAN Golgi autoantigen, golgin subfamily A member 4[51 .. A 45.5
/32.3
11
/11
ARL1_RAT ADP-ribosylation factor-like protein 1
1upt[4] B GOA4_HUMAN GOLGI AUTOANTIGEN, GOLGIN SUBFAMILY A MEMBER 4[58 .. A 40.0
/31.5
10
/10
ARL1_HUMAN ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 1
5ee5[1] A BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange .. B 35.7
/31.7
14
/14
ARL1_HUMAN ADP-ribosylation factor-like protein 1
1m2o[8] A SEC23_YEAST protein transport protein SEC23[718 aa] B 14.3
/30.9
28
/30
SAR1_YEAST GTP-binding protein SAR1
2qtv[2] A SEC23_YEAST Protein transport protein SEC23[733 aa] B 13.8
/31.0
29
/29
SAR1_YEAST Small COPII coat GTPase SAR1
4bzi[3] F E7QAP0_YEASB SEC23P[733 aa] B 75.0
/31.0
4
/4
C8ZIG2_YEAS8 SAR1P
5j5c[1] B BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange .. A 33.3
/31.5
18
/18
ARL1_HUMAN ADP-ribosylation factor-like protein 1
1j2j[1] B GGA1_HUMAN ADP-ribosylation factor binding protein GGA1[41 aa.. A 40.0
/31.4
10
/10
ARF2_MOUSE ADP-ribosylation factor 1
2j59[6] G Q8NI19_HUMAN RHO-GTPASE ACTIVATING PROTEIN 10[113 aa] A 33.3
/31.4
15
/15
ARF1_MOUSE ADP-RIBOSYLATION FACTOR 1
3doe[2] B AR2BP_HUMAN ADP-ribosylation factor-like protein 2-binding pro.. A 45.5
/31.3
11
/19
ARL2_HUMAN ADP-ribosylation factor-like protein 2
1ukv[1] A GDI1_YEAST Secretory pathway GDP dissociation inhibitor[442 a.. B 55.0
/31.3
20
/32
YPT1_YEAST GTP-binding protein YPT1
4dcn[2] C ARFP2_HUMAN Arfaptin-2[193 aa] A 46.7
/31.3
15
/15
ARL1_HUMAN ADP-ribosylation factor-like protein 1
2qtv[1] C SEC31_YEAST Protein transport protein SEC31[36 aa] B 42.9
/31.0
14
/14
SAR1_YEAST Small COPII coat GTPase SAR1
6fae[1] A IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2[335 .. B 57.1
/30.9
28
/28
ARF1_HUMAN ADP-ribosylation factor 1
1ksh[2] B PDE6D_HUMAN RETINAL ROD RHODOPSIN-SENSITIVE CGMP 3',5'-CYCLIC .. A 35.3
/30.3
17
/17
ARL2_MOUSE arf-like protein 2
1ksg[1] B PDE6D_HUMAN RETINAL ROD RHODOPSIN-SENSITIVE CGMP 3',5'-CYCLIC .. A 35.3
/30.1
17
/17
ARL2_MOUSE arf-like protein 2
4v0m[3] B A8JEA1_CHLRE BARDET-BIEDL SYNDROME 1 PROTEIN[333 aa] A 16.7
/29.8
12
/12
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0m[1] D A8JEA1_CHLRE BARDET-BIEDL SYNDROME 1 PROTEIN[303 aa] C 16.7
/29.8
12
/12
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0m[2] F A8JEA1_CHLRE BARDET-BIEDL SYNDROME 1 PROTEIN[309 aa] E 18.2
/29.2
11
/11
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0m[3] H A8JEA1_CHLRE BARDET-BIEDL SYNDROME 1 PROTEIN[325 aa] G 18.2
/29.8
11
/11
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0n[1] D A8JEA1_CHLRE BARDET-BIEDL SYNDROME 1 PROTEIN[304 aa] C 16.7
/29.8
12
/12
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0n[1] F A8JEA1_CHLRE BARDET-BIEDL SYNDROME 1 PROTEIN[304 aa] E 15.4
/29.8
13
/13
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0o[1] D A8JEA1_CHLRE BARDET-BIEDL SYNDROME 1 PROTEIN[307 aa] C 23.1
/29.8
13
/13
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4goj[2] C U119A_HUMAN Protein unc-119 homolog A[161 aa] A 42.1
/34.2
19
/20
ARL3_MOUSE ADP-ribosylation factor-like protein 3
4gok[2] B U119A_HUMAN Protein unc-119 homolog A[161 aa] A 38.5
/29.9
13
/13
ARL2_MOUSE ADP-ribosylation factor-like protein 2
4hlq[5] A TBC20_HUMAN TBC1 domain family member 20[280 aa] B 55.0
/28.9
20
/23
RAB1B_HUMAN Ras-related protein Rab-1B
1ibr[2] B IMB1_HUMAN Importin beta-1 subunit[458 aa] A 15.4
/25.8
26
/29
RAN_HUMAN GTP-binding nuclear protein RAN
1qbk[2] A TNPO1_HUMAN KARYOPHERIN BETA2[880 aa] B 13.5
/25.8
37
/41
RAN_HUMAN RAN
1rrp[4] B RBP2_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP358[134 aa] A 26.7
/25.8
15
/43
RAN_HUMAN RAN
1rrp[4] D RBP2_HUMAN NUCLEAR PORE COMPLEX PROTEIN NUP358[134 aa] A 0.0
/25.8
1
/1
RAN_HUMAN RAN
5cll[6] B RBP2_HUMAN E3 SUMO-protein ligase RanBP2[139 aa] A 23.5
/25.8
17
/34
RAN_HUMAN GTP-binding nuclear protein Ran
1wa5[1] B A0A6A5Q590_YEASX SRP1 isoform 1[466 aa] A 20.0
/25.8
5
/5
RAN_CANLF GTP-binding nuclear protein Ran
1wa5[1] C CSE1_YEAST Importin alpha re-exporter[950 aa] A 21.9
/25.8
32
/32
RAN_CANLF GTP-binding nuclear protein Ran
2bku[4] B IMB1_YEAST IMPORTIN BETA-1 SUBUNIT[857 aa] A 21.6
/26.5
37
/39
RAN_CANFA GTP-BINDING NUCLEAR PROTEIN RAN
3a6p[4] A XPO5_HUMAN Exportin-5[1072 aa] C 23.1
/25.8
26
/29
RAN_CANFA GTP-binding nuclear protein Ran
3gj3[1] B NU153_RAT Nuclear pore complex protein Nup153[27 aa] A 14.3
/25.8
14
/14
RAN_HUMAN GTP-binding nuclear protein Ran
3w3z[1] A IMB3_YEAST Importin subunit beta-3[1013 aa] B 16.7
/25.8
24
/24
RAN_CANFA GTP-binding nuclear protein Ran
4gmx[31] B YRB1_YEAST Ran-specific GTPase-activating protein 1[123 aa] A 12.5
/25.8
8
/35
RAN_HUMAN GTP-binding nuclear protein Ran
4gmx[31] C XPO1_YEAST Exportin-1[1015 aa] A 15.4
/25.8
26
/31
RAN_HUMAN GTP-binding nuclear protein Ran
4ol0[1] B TNPO3_HUMAN Transportin-3[902 aa] A 16.1
/25.8
31
/32
RAN_HUMAN GTP-binding nuclear protein Ran
7mnx[5] B RBP2_HUMAN E3 SUMO-protein ligase RanBP2[130 aa] A 21.4
/25.8
14
/48
RAN_HUMAN GTP-binding nuclear protein Ran
7mny[2] B RBP2_HUMAN E3 SUMO-protein ligase RanBP2[129 aa] A 25.0
/26.2
12
/39
RAN_HUMAN GTP-binding nuclear protein Ran
7mnz[3] D RBP2_HUMAN E3 SUMO-protein ligase RanBP2[138 aa] C 16.7
/25.8
12
/46
RAN_HUMAN GTP-binding nuclear protein Ran
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
186 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3a6p[2] D pre-microRNA C 0.0
/25.8
1
/1
RAN_CANFA GTP-binding nuclear protein Ran
3a6p[2] E pre-microRNA C 0.0
/25.8
1
/1
RAN_CANFA GTP-binding nuclear protein Ran
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
186 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2j5x[2] C GSP
5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE[32 atom..
A 63.2
/35.6
19
/19
ARF6_HUMAN ADP-RIBOSYLATION FACTOR 6
2hei[2] D D1D
(4S,5S)-1,2-DITHIANE-4,5-DIOL[8 atoms]
A 18.2
/35.5
11
/11
RAB5B_HUMAN Ras-related protein Rab-5B
3nkv[2] F AMP
ADENOSINE MONOPHOSPHATE[22 atoms]
A 100.0
/33.0
3
/5
RAB1B_HUMAN Ras-related protein Rab-1B
1mr3[12] C G3D
GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE[32 atoms..
A 62.5
/33.7
16
/16
ARF2_YEAST ADP-ribosylation factor 2
1r8q[2] J G3D
GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE[32 atoms..
A 100.0
/33.3
1
/1
ARF1_BOVIN ADP-ribosylation factor 1
4c0a[4] I G3D
GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE[32 atoms..
C 57.1
/32.1
14
/14
ARF1_BOVIN ADP-RIBOSYLATION FACTOR 1
7eq2[2] E NCO
COBALT HEXAMMINE(III)[7 atoms]
A 16.7
/33.0
6
/6
RAB1A_HUMAN Ras-related protein Rab-1A
7eq2[2] F NCO
COBALT HEXAMMINE(III)[7 atoms]
A 33.3
/33.0
3
/3
RAB1A_HUMAN Ras-related protein Rab-1A
2ksq[1] B MTN
S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrr..
A 0.0
/32.7
1
/1
ARF1_YEAST ADP-ribosylation factor 1
2ksq[1] C MTN
S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrr..
A 0.0
/32.7
1
/1
ARF1_YEAST ADP-ribosylation factor 1
2ksq[1] D MTN
S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrr..
A 0.0
/32.7
1
/1
ARF1_YEAST ADP-ribosylation factor 1
2ksq[1] E MTN
S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrr..
A 25.0
/32.7
4
/4
ARF1_YEAST ADP-ribosylation factor 1
1r8q[5] G AFB
1,6,7,8,9,11A,12,13,14,14A-DECAHYDRO-1,13-DIHYDROX..
A 55.6
/33.3
9
/9
ARF1_BOVIN ADP-ribosylation factor 1
1re0[2] E AFB
1,6,7,8,9,11A,12,13,14,14A-DECAHYDRO-1,13-DIHYDROX..
A 60.0
/32.1
10
/10
ARF1_HUMAN ADP-ribosylation factor 1
1byu[143] D GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 64.3
/26.5
14
/14
RAN_CANFA PROTEIN (GTP-BINDING PROTEIN RAN)
1ek0[1] E GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 0.0
/29.7
3
/5
YPT51_YEAST PROTEIN (GTP-BINDING PROTEIN YPT51)
1hur[22] F GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 66.7
/31.8
3
/3
ARF1_HUMAN HUMAN ADP-RIBOSYLATION FACTOR 1
1tu4[4] K GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 40.0
/36.3
5
/5
RAB5A_HUMAN Ras-related protein Rab-5A
2b6h[2] D GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 100.0
/31.7
2
/2
ARF5_HUMAN ADP-ribosylation factor 5
3lvq[2] D GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 56.2
/35.6
16
/19
ASAP3_HUMAN ARF6_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-..
3o47[4] D GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 62.5
/32.5
16
/16
ARFG1_HUMAN ARF1_HUMAN ADP-ribosylation factor GTPase-activating protein ..
1j2j[163] E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 68.4
/31.4
19
/19
ARF2_MOUSE ADP-ribosylation factor 1
2h57[14] E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 76.5
/34.3
17
/20
ARL6_HUMAN ADP-ribosylation factor-like protein 6
6bbp[2] B GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 65.0
/34.5
20
/20
CYH3_MOUSE ARF6_HUMAN Cytohesin-3,ADP-ribosylation factor 6
1ek0[113] D GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato..
A 59.1
/29.7
22
/22
YPT51_YEAST PROTEIN (GTP-BINDING PROTEIN YPT51)
8dzm[9] E G4P
GUANOSINE-5',3'-TETRAPHOSPHATE[36 atoms]
A 69.2
/33.6
13
/16
SAR1A_HUMAN GTP-binding protein SAR1a
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
186 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1tu4[8] E CO
COBALT (II) ION[1 atoms]
A 0.0
/36.3
1
/1
RAB5A_HUMAN Ras-related protein Rab-5A
1tu4[8] H CO
COBALT (II) ION[1 atoms]
A 0.0
/36.3
2
/2
RAB5A_HUMAN Ras-related protein Rab-5A
4iru[1] Y K
POTASSIUM ION[1 atoms]
B 100.0
/33.0
1
/2
RAB1A_HUMAN Ras-related protein Rab-1A
4kax[1] G K
POTASSIUM ION[1 atoms]
A 0.0
/35.3
2
/2
ARF6_HUMAN ADP-ribosylation factor 6
2b6h[14] E UNX
UNKNOWN ATOM OR ION[1 atoms]
A 50.0
/31.7
4
/4
ARF5_HUMAN ADP-ribosylation factor 5
2b6h[3] F UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/31.7
1
/1
ARF5_HUMAN ADP-ribosylation factor 5
2b6h[3] H UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/31.7
2
/2
ARF5_HUMAN ADP-ribosylation factor 5
2b6h[2] H UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/31.7
1
/1
ARF5_HUMAN ADP-ribosylation factor 5
2b6h[9] I UNX
UNKNOWN ATOM OR ION[1 atoms]
A 50.0
/31.7
2
/2
ARF5_HUMAN ADP-ribosylation factor 5
2gf9[2] D UNX
UNKNOWN ATOM OR ION[1 atoms]
A 50.0
/29.2
2
/2
RAB3D_HUMAN Ras-related protein Rab-3D
2h16[3] F UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/31.2
3
/3
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h16[5] G UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/31.2
1
/1
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h16[7] H UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/31.2
1
/1
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h16[3] I UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/31.2
2
/2
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h16[1] J UNX
UNKNOWN ATOM OR ION[1 atoms]
A 25.0
/31.2
4
/4
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h16[1] Q UNX
UNKNOWN ATOM OR ION[1 atoms]
B 0.0
/31.0
1
/1
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h16[1] Y UNX
UNKNOWN ATOM OR ION[1 atoms]
C 100.0
/30.0
4
/4
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h16[1] Z UNX
UNKNOWN ATOM OR ION[1 atoms]
C 0.0
/30.0
2
/2
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h17[2] C UNX
UNKNOWN ATOM OR ION[1 atoms]
A 25.0
/33.3
4
/4
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h17[1] D UNX
UNKNOWN ATOM OR ION[1 atoms]
A 100.0
/33.3
1
/1
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h17[1] E UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/33.3
2
/2
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h18[1] D UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/93.5
1
/1
ARL8A_HUMAN ADP-ribosylation factor-like protein 8A
2h57[1] F UNX
UNKNOWN ATOM OR ION[1 atoms]
A 33.3
/34.3
3
/3
ARL6_HUMAN ADP-ribosylation factor-like protein 6
2h57[1] G UNX
UNKNOWN ATOM OR ION[1 atoms]
A 0.0
/34.3
1
/1
ARL6_HUMAN ADP-ribosylation factor-like protein 6
2h57[1] L UNX
UNKNOWN ATOM OR ION[1 atoms]
B 50.0
/34.0
2
/2
ARL6_HUMAN ADP-ribosylation factor-like protein 6
2h57[1] R UNX
UNKNOWN ATOM OR ION[1 atoms]
C 50.0
/34.3
2
/2
ARL6_HUMAN ADP-ribosylation factor-like protein 6
1e0s[1] D NH4
AMMONIUM ION[1 atoms]
A 100.0
/35.3
2
/2
ARF6_HUMAN ADP-ribosylation factor 6
1fzq[1] D NH4
AMMONIUM ION[1 atoms]
A 100.0
/34.2
1
/1
ARL3_MOUSE ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
1byu[398] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/26.5
1
/1
RAN_CANFA PROTEIN (GTP-BINDING PROTEIN RAN)
3lvq[2] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/35.6
4
/4
ASAP3_HUMAN ARF6_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-..
3lvq[1] F MG
MAGNESIUM ION[1 atoms]
A 0.0
/35.6
2
/4
ASAP3_HUMAN ARF6_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-..
5ee5[1] S MG
MAGNESIUM ION[1 atoms]
B 50.0
/31.7
6
/6
ARL1_HUMAN ADP-ribosylation factor-like protein 1
6bbp[2] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/34.5
2
/2
CYH3_MOUSE ARF6_HUMAN Cytohesin-3,ADP-ribosylation factor 6
3nkv[1] E BA
BARIUM ION[1 atoms]
A 0.0
/33.0
1
/3
RAB1B_HUMAN Ras-related protein Rab-1B
3o47[2] C ZN
ZINC ION[1 atoms]
A 0.0
/32.5
1
/5
ARFG1_HUMAN ARF1_HUMAN ADP-ribosylation factor GTPase-activating protein ..
2b6h[3] B CL
CHLORIDE ION[1 atoms]
A 100.0
/31.7
1
/3
ARF5_HUMAN ADP-ribosylation factor 5
2b6h[2] B CL
CHLORIDE ION[1 atoms]
A 0.0
/31.7
1
/1
ARF5_HUMAN ADP-ribosylation factor 5
3n5c[3] D CL
CHLORIDE ION[1 atoms]
A 20.0
/32.7
5
/5
ARF6_HUMAN ADP-ribosylation factor 6
4gpt[2] G CL
CHLORIDE ION[1 atoms]
A 25.0
/25.8
4
/4
RAN_HUMAN GTP-binding nuclear protein Ran
4hav[2] F CL
CHLORIDE ION[1 atoms]
A 50.0
/25.8
2
/2
RAN_HUMAN GTP-binding nuclear protein Ran
5ee5[1] DA CL
CHLORIDE ION[1 atoms]
B 33.3
/31.7
3
/3
ARL1_HUMAN ADP-ribosylation factor-like protein 1
5ee5[1] AA NA
SODIUM ION[1 atoms]
B 50.0
/31.7
2
/2
ARL1_HUMAN ADP-ribosylation factor-like protein 1
5ee5[1] BA NA
SODIUM ION[1 atoms]
B 0.0
/31.7
1
/1
ARL1_HUMAN ADP-ribosylation factor-like protein 1
5ee5[1] D NA
SODIUM ION[1 atoms]
B 0.0
/31.7
1
/1
ARL1_HUMAN ADP-ribosylation factor-like protein 1
5ee5[1] U NA
SODIUM ION[1 atoms]
B 0.0
/31.7
1
/1
ARL1_HUMAN ADP-ribosylation factor-like protein 1
5ee5[1] V NA
SODIUM ION[1 atoms]
B 100.0
/31.7
1
/1
ARL1_HUMAN ADP-ribosylation factor-like protein 1
5ee5[1] W NA
SODIUM ION[1 atoms]
B 0.0
/31.7
2
/2
ARL1_HUMAN ADP-ribosylation factor-like protein 1
5ee5[1] Y NA
SODIUM ION[1 atoms]
B 0.0
/31.7
1
/1
ARL1_HUMAN ADP-ribosylation factor-like protein 1
1j2j[1] D IOD
IODIDE ION[1 atoms]
A 33.3
/31.4
3
/3
ARF2_MOUSE ADP-ribosylation factor 1
3lvr[1] F CA
CALCIUM ION[1 atoms]
A 25.0
/35.6
4
/5
ASAP3_HUMAN ARF6_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-..
8dzo[1] G CA
CALCIUM ION[1 atoms]
B 50.0
/30.8
2
/2
SAR1A_HUMAN GTP-binding protein SAR1a
4v0k[1] D CD
CADMIUM ION[1 atoms]
A 33.3
/30.6
3
/3
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0k[3] E CD
CADMIUM ION[1 atoms]
A 100.0
/30.6
2
/2
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0k[2] G CD
CADMIUM ION[1 atoms]
A 0.0
/30.6
2
/2
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0k[1] H CD
CADMIUM ION[1 atoms]
A 40.0
/30.6
5
/5
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0k[1] K CD
CADMIUM ION[1 atoms]
B 50.0
/30.0
2
/2
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0k[1] M CD
CADMIUM ION[1 atoms]
B 33.3
/30.0
3
/3
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0n[4] K HG
MERCURY (II) ION[1 atoms]
A 0.0
/29.8
2
/2
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0o[3] K PB
LEAD (II) ION[1 atoms]
A 50.0
/29.8
2
/2
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
4v0o[1] L PB
LEAD (II) ION[1 atoms]
A 0.0
/29.8
1
/1
A8JF99_CHLRE ARF-LIKE SMALL GTPASE
1ek0[1] C NI
NICKEL (II) ION[1 atoms]
A 0.0
/29.7
2
/2
YPT51_YEAST PROTEIN (GTP-BINDING PROTEIN YPT51)
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
186 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1tu4[16] B RAB5A_HUMAN Ras-related protein Rab-5A[162 aa] A 38.5
/36.3
13
/15
RAB5A_HUMAN Ras-related protein Rab-5A
1tu4[16] B RAB5A_HUMAN Ras-related protein Rab-5A[162 aa] A 33.3
/36.3
9
/10
RAB5A_HUMAN Ras-related protein Rab-5A
1tu4[4] A RAB5A_HUMAN Ras-related protein Rab-5A[169 aa] B 42.9
/36.4
7
/10
RAB5A_HUMAN Ras-related protein Rab-5A
2w83[2] E ARF6_HUMAN ADP-RIBOSYLATION FACTOR 6[162 aa] A 28.6
/35.7
14
/14
ARF6_HUMAN ADP-RIBOSYLATION FACTOR 6
6pta[4] C ARF_CANAL ADP-ribosylation factor[164 aa] A 30.8
/36.1
13
/13
ARF_CANAL ADP-ribosylation factor
2hei[1] B RAB5B_HUMAN Ras-related protein Rab-5B[165 aa] A 61.5
/35.5
13
/15
RAB5B_HUMAN Ras-related protein Rab-5B
2hei[1] A RAB5B_HUMAN Ras-related protein Rab-5B[163 aa] B 33.3
/35.2
15
/17
RAB5B_HUMAN Ras-related protein Rab-5B
3lrp[2] A ARF1_PLAFA ADP-ribosylation factor 1[181 aa] A 45.5
/34.9
11
/11
ARF1_PLAFA ADP-ribosylation factor 1
4y0v[4] B C4LXL1_ENTHI ADP-ribosylation factor 1[161 aa] A 20.0
/33.8
10
/10
C4LXL1_ENTHI ADP-ribosylation factor 1
1f6b[2] B SAR1B_CRIGR SAR1[180 aa] A 12.5
/34.1
16
/16
SAR1B_CRIGR SAR1
1r4a[1] G ARL1_RAT ADP-ribosylation factor-like protein 1[165 aa] A 100.0
/32.3
1
/1
ARL1_RAT ADP-ribosylation factor-like protein 1
1r4a[2] E ARL1_RAT ADP-ribosylation factor-like protein 1[165 aa] C 100.0
/32.3
1
/1
ARL1_RAT ADP-ribosylation factor-like protein 1
1hur[10] B ARF1_HUMAN HUMAN ADP-RIBOSYLATION FACTOR 1[180 aa] A 20.0
/31.8
10
/10
ARF1_HUMAN HUMAN ADP-RIBOSYLATION FACTOR 1
1r8q[4] C ARF1_BOVIN ADP-ribosylation factor 1[179 aa] A 28.6
/33.3
14
/14
ARF1_BOVIN ADP-ribosylation factor 1
3o47[4] A ARFG1_HUMAN ARF1_HUMAN ADP-ribosylation factor GTPase-activating protein .. A 14.3
/32.5
7
/16
ARFG1_HUMAN ARF1_HUMAN ADP-ribosylation factor GTPase-activating protein ..
2b6h[2] A ARF5_HUMAN ADP-ribosylation factor 5[171 aa] A 14.3
/31.7
14
/15
ARF5_HUMAN ADP-ribosylation factor 5
2b6h[2] A ARF5_HUMAN ADP-ribosylation factor 5[171 aa] A 33.3
/31.7
12
/12
ARF5_HUMAN ADP-ribosylation factor 5
1zj6[2] A ARL5A_HUMAN ADP-ribosylation factor-like protein 5[173 aa] A 60.0
/33.8
5
/14
ARL5A_HUMAN ADP-ribosylation factor-like protein 5
1zj6[2] A ARL5A_HUMAN ADP-ribosylation factor-like protein 5[173 aa] A 33.3
/33.8
9
/9
ARL5A_HUMAN ADP-ribosylation factor-like protein 5
2h16[4] C ARL5A_HUMAN ADP-ribosylation factor-like protein 5A[152 aa] A 25.0
/31.2
8
/15
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2h16[4] D ARL5A_HUMAN ADP-ribosylation factor-like protein 5A[153 aa] A 60.0
/31.2
10
/13
ARL5A_HUMAN ADP-ribosylation factor-like protein 5A
2gao[2] B SAR1A_HUMAN GTP-binding protein SAR1a[171 aa] A 22.2
/31.2
9
/9
SAR1A_HUMAN GTP-binding protein SAR1a
2x77[1] A Q4QEJ1_LEIMA ADP-RIBOSYLATION FACTOR[181 aa] B 25.0
/30.9
4
/5
Q4QEJ1_LEIMA ADP-RIBOSYLATION FACTOR
4bas[2] A C9ZVV9_TRYB9 ADP-RIBOSYLATION FACTOR, PUTATIVE (SMALL GTPASE, P.. A 28.6
/29.0
14
/15
C9ZVV9_TRYB9 ADP-RIBOSYLATION FACTOR, PUTATIVE (SMALL GTPASE, P..
2x77[1] B Q4QEJ1_LEIMA ADP-RIBOSYLATION FACTOR[166 aa] A 0.0
/27.7
2
/2
Q4QEJ1_LEIMA ADP-RIBOSYLATION FACTOR
1byu[2] B RAN_CANFA PROTEIN (GTP-BINDING PROTEIN RAN)[215 aa] A 0.0
/26.5
5
/7
RAN_CANFA PROTEIN (GTP-BINDING PROTEIN RAN)
1rrp[4] C RAN_HUMAN RAN[180 aa] A 50.0
/25.8
2
/2
RAN_HUMAN RAN
1rrp[4] C RAN_HUMAN RAN[180 aa] A 0.0
/25.8
5
/6
RAN_HUMAN RAN
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
186 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2j59[3] O DIO
1,4-DIETHYLENE DIOXIDE[6 atoms]
A 0.0
/31.4
3
/3
ARF1_MOUSE ADP-RIBOSYLATION FACTOR 1
2w83[4] H DIO
1,4-DIETHYLENE DIOXIDE[6 atoms]
A 0.0
/35.7
5
/5
ARF6_HUMAN ADP-RIBOSYLATION FACTOR 6
2w83[3] L DIO
1,4-DIETHYLENE DIOXIDE[6 atoms]
A 0.0
/35.7
2
/2
ARF6_HUMAN ADP-RIBOSYLATION FACTOR 6
2w83[1] Q DIO
1,4-DIETHYLENE DIOXIDE[6 atoms]
E 0.0
/35.7
2
/2
ARF6_HUMAN ADP-RIBOSYLATION FACTOR 6
1re0[1] F CIT
CITRIC ACID[13 atoms]
A 33.3
/32.1
6
/6
ARF1_HUMAN ADP-ribosylation factor 1
4kax[1] E CIT
CITRIC ACID[13 atoms]
A 0.0
/35.3
1
/1
ARF6_HUMAN ADP-ribosylation factor 6
3bh7[1] D ALF
TETRAFLUOROALUMINATE ION[5 atoms]
A 77.8
/34.4
9
/9
ARL3_MOUSE ADP-ribosylation factor-like protein 3
1fzq[1] E MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 0.0
/34.2
4
/4
ARL3_MOUSE ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
1ksh[2] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/30.3
6
/8
ARL2_MOUSE arf-like protein 2
3jza[1] C PO4
PHOSPHATE ION[5 atoms]
A 20.0
/33.0
5
/5
RAB1B_HUMAN Ras-related protein Rab-1B
7ok7[4] FA PO4
PHOSPHATE ION[5 atoms]
A 0.0
/34.2
3
/3
ARL3_MOUSE ADP-ribosylation factor-like protein 3
1mr3[1] P EOH
ETHANOL[3 atoms]
A 71.4
/33.7
7
/7
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] Q EOH
ETHANOL[3 atoms]
A 0.0
/33.7
1
/1
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] R EOH
ETHANOL[3 atoms]
A 0.0
/33.7
2
/2
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] S EOH
ETHANOL[3 atoms]
A 0.0
/33.7
1
/1
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] T PDO
1,3-PROPANDIOL[5 atoms]
A 66.7
/33.7
6
/6
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] U PDO
1,3-PROPANDIOL[5 atoms]
A 80.0
/33.7
5
/5
ARF2_YEAST ADP-ribosylation factor 2
1n6k[13] D AF3
ALUMINUM FLUORIDE[4 atoms]
A 42.9
/36.3
7
/7
RAB5A_HUMAN Ras-related protein Rab-5A
3lvq[2] E AF3
ALUMINUM FLUORIDE[4 atoms]
A 75.0
/35.6
8
/9
ASAP3_HUMAN ARF6_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-..
4iru[3] U AF3
ALUMINUM FLUORIDE[4 atoms]
B 40.0
/33.0
10
/10
RAB1A_HUMAN Ras-related protein Rab-1A
4jvs[1] E AF3
ALUMINUM FLUORIDE[4 atoms]
B 44.4
/33.0
9
/9
RAB1A_HUMAN Ras-related protein Rab-1A
7eq2[2] G MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 50.0
/33.0
6
/6
RAB1A_HUMAN Ras-related protein Rab-1A
7eq2[1] M CAC
CACODYLATE ION[5 atoms]
B 0.0
/33.0
2
/2
RAB1A_HUMAN Ras-related protein Rab-1A
7eq2[1] N CAC
CACODYLATE ION[5 atoms]
B 33.3
/33.0
3
/3
RAB1A_HUMAN Ras-related protein Rab-1A
4hlq[11] N BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
B 33.3
/28.9
9
/9
RAB1B_HUMAN Ras-related protein Rab-1B
7mge[1] F BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
D 83.3
/32.5
6
/6
ARF1_HUMAN ADP-ribosylation factor 1
1f6b[4] E SO4
SULFATE ION[5 atoms]
A 0.0
/34.1
2
/2
SAR1B_CRIGR SAR1
1f6b[6] F SO4
SULFATE ION[5 atoms]
A 0.0
/34.1
1
/4
SAR1B_CRIGR SAR1
1fzq[3] B SO4
SULFATE ION[5 atoms]
A 100.0
/34.2
1
/4
ARL3_MOUSE ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
1fzq[1] C SO4
SULFATE ION[5 atoms]
A 20.0
/34.2
5
/5
ARL3_MOUSE ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
1tu4[12] R SO4
SULFATE ION[5 atoms]
A 100.0
/36.3
1
/1
RAB5A_HUMAN Ras-related protein Rab-5A
1tu4[4] R SO4
SULFATE ION[5 atoms]
B 100.0
/36.4
1
/1
RAB5A_HUMAN Ras-related protein Rab-5A
1zj6[3] B SO4
SULFATE ION[5 atoms]
A 75.0
/33.8
4
/4
ARL5A_HUMAN ADP-ribosylation factor-like protein 5
1zj6[4] B SO4
SULFATE ION[5 atoms]
A 33.3
/33.8
3
/3
ARL5A_HUMAN ADP-ribosylation factor-like protein 5
2b6h[5] C SO4
SULFATE ION[5 atoms]
A 0.0
/31.7
5
/5
ARF5_HUMAN ADP-ribosylation factor 5
3l0i[3] J SO4
SULFATE ION[5 atoms]
D 40.0
/33.0
5
/5
RAB1A_HUMAN Ras-related protein Rab-1A
3lrp[2] D SO4
SULFATE ION[5 atoms]
A 75.0
/34.9
4
/4
ARF1_PLAFA ADP-ribosylation factor 1
4bas[2] D SO4
SULFATE ION[5 atoms]
A 50.0
/29.0
4
/4
C9ZVV9_TRYB9 ADP-RIBOSYLATION FACTOR, PUTATIVE (SMALL GTPASE, P..
4bas[2] E SO4
SULFATE ION[5 atoms]
A 20.0
/29.0
5
/5
C9ZVV9_TRYB9 ADP-RIBOSYLATION FACTOR, PUTATIVE (SMALL GTPASE, P..
1e0s[1] C BME
BETA-MERCAPTOETHANOL[4 atoms]
A 33.3
/35.3
3
/3
ARF6_HUMAN ADP-ribosylation factor 6
1ksj[1] E BME
BETA-MERCAPTOETHANOL[4 atoms]
A 28.6
/30.3
7
/8
ARL2_MOUSE arf-like protein 2
1n6h[7] D BME
BETA-MERCAPTOETHANOL[4 atoms]
A 25.0
/36.3
4
/5
RAB5A_HUMAN Ras-related protein Rab-5A
1r8s[2] D BME
BETA-MERCAPTOETHANOL[4 atoms]
A 33.3
/32.1
3
/3
ARF1_BOVIN ADP-ribosylation factor 1
1r8s[2] E FMT
FORMIC ACID[3 atoms]
A 40.0
/32.1
5
/5
ARF1_BOVIN ADP-ribosylation factor 1
1r8s[2] F FMT
FORMIC ACID[3 atoms]
A 0.0
/32.1
2
/2
ARF1_BOVIN ADP-ribosylation factor 1
1r8s[2] H SO3
SULFITE ION[4 atoms]
A 100.0
/32.1
1
/1
ARF1_BOVIN ADP-ribosylation factor 1
4iru[1] V ACT
ACETATE ION[4 atoms]
B 66.7
/33.0
3
/3
RAB1A_HUMAN Ras-related protein Rab-1A
4iru[2] W ACT
ACETATE ION[4 atoms]
B 25.0
/33.0
4
/4
RAB1A_HUMAN Ras-related protein Rab-1A
4iru[1] BA ACT
ACETATE ION[4 atoms]
D 0.0
/33.0
1
/1
RAB1A_HUMAN Ras-related protein Rab-1A
4iru[1] LA ACT
ACETATE ION[4 atoms]
D 66.7
/33.0
3
/4
RAB1A_HUMAN Ras-related protein Rab-1A
4iru[1] Z ACT
ACETATE ION[4 atoms]
D 100.0
/33.0
1
/1
RAB1A_HUMAN Ras-related protein Rab-1A
5ee5[1] EA ACT
ACETATE ION[4 atoms]
B 0.0
/31.7
1
/1
ARL1_HUMAN ADP-ribosylation factor-like protein 1
1mr3[1] D EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/33.7
2
/2
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] E EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/33.7
2
/2
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] F EDO
1,2-ETHANEDIOL[4 atoms]
A 75.0
/33.7
4
/4
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/33.7
3
/3
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/33.7
4
/4
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/33.7
3
/3
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/33.7
3
/3
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] K EDO
1,2-ETHANEDIOL[4 atoms]
A 14.3
/33.7
7
/7
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] L EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/33.7
2
/2
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] M EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/33.7
3
/4
ARF2_YEAST ADP-ribosylation factor 2
2j59[1] U EDO
1,2-ETHANEDIOL[4 atoms]
C 50.0
/31.4
4
/4
ARF1_MOUSE ADP-RIBOSYLATION FACTOR 1
2j59[1] Z EDO
1,2-ETHANEDIOL[4 atoms]
E 0.0
/31.4
3
/5
ARF1_MOUSE ADP-RIBOSYLATION FACTOR 1
4gmx[10] F EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/25.8
4
/4
RAN_HUMAN GTP-binding nuclear protein Ran
6fae[1] C EDO
1,2-ETHANEDIOL[4 atoms]
B 0.0
/30.9
2
/2
ARF1_HUMAN ADP-ribosylation factor 1
4i1o[3] L PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 50.0
/28.9
4
/4
RAB1B_HUMAN Ras-related protein Rab-1B
4i1o[1] Q PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
C 50.0
/28.9
4
/5
RAB1B_HUMAN Ras-related protein Rab-1B
4i1o[1] R PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
C 42.9
/28.9
7
/7
RAB1B_HUMAN Ras-related protein Rab-1B
1mr3[1] N GOL
GLYCEROL[6 atoms]
A 33.3
/33.7
6
/6
ARF2_YEAST ADP-ribosylation factor 2
1mr3[1] O GOL
GLYCEROL[6 atoms]
A 100.0
/33.7
5
/5
ARF2_YEAST ADP-ribosylation factor 2
1r2q[1] D GOL
GLYCEROL[6 atoms]
A 0.0
/36.3
2
/2
RAB5A_HUMAN Ras-related protein Rab-5A
1r2q[3] E GOL
GLYCEROL[6 atoms]
A 0.0
/36.3
1
/2
RAB5A_HUMAN Ras-related protein Rab-5A
1r2q[6] F GOL
GLYCEROL[6 atoms]
A 50.0
/36.3
4
/4
RAB5A_HUMAN Ras-related protein Rab-5A
1r2q[10] G GOL
GLYCEROL[6 atoms]
A 50.0
/36.3
2
/2
RAB5A_HUMAN Ras-related protein Rab-5A
1r2q[4] I GOL
GLYCEROL[6 atoms]
A 50.0
/36.3
4
/6
RAB5A_HUMAN Ras-related protein Rab-5A
2a5d[1] F GOL
GLYCEROL[6 atoms]
A 0.0
/35.6
2
/2
ARF6_HUMAN ADP-ribosylation factor 6
4iru[2] M GOL
GLYCEROL[6 atoms]
B 0.0
/33.0
1
/1
RAB1A_HUMAN Ras-related protein Rab-1A
4wvf[1] G GOL
GLYCEROL[6 atoms]
A 0.0
/25.8
5
/5
RAN_HUMAN GTP-binding nuclear protein Ran
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.