Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4044213 1041 500 Q9NR97(TLR8_HUMAN) RecName: Full=Toll-like receptor 8 ;AltName: CD_antigen=CD288;Flags: Precursor;
QUERYSEQ
MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTE
LSLIQNNIYNITKEGISRLINLKNLYLAWNCYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLR
KINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNLEIIYLSENRISPLVKDTRQSYANSSSFQRH
IRKRRSTDFEFDPHSNFYHFTRPLIKPQCAAYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLT
DKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFLNLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSNLLKT
INKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITTMVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINE
LRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAFYLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRNVVLTENDSRYNNMYVDSIKQY
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q9NR97(TLR8_HUMAN)]

1041
region name description
1-26 SIGNAL
27-1041 CHAIN /note="Toll-like receptor 8" /id="PRO_0000034735"
27-827 TOPO_DOM /note="Extracellular"
828-848 TRANSMEM /note="Helical"
849-1041 TOPO_DOM /note="Cytoplasmic"
126-147 REPEAT /note="LRR 1"
148-168 REPEAT /note="LRR 2"
171-193 REPEAT /note="LRR 3"
202-223 REPEAT /note="LRR 4"
224-244 REPEAT /note="LRR 5"
247-268 REPEAT /note="LRR 6"
288-309 REPEAT /note="LRR 7"
312-334 REPEAT /note="LRR 8"
338-360 REPEAT /note="LRR 9"
368-389 REPEAT /note="LRR 10"
395-416 REPEAT /note="LRR 11"
419-440 REPEAT /note="LRR 12"
482-503 REPEAT /note="LRR 13"
506-527 REPEAT /note="LRR 14"
531-551 REPEAT /note="LRR 15"
555-577 REPEAT /note="LRR 16"
585-606 REPEAT /note="LRR 17"
609-630 REPEAT /note="LRR 18"
640-661 REPEAT /note="LRR 19"
665-685 REPEAT /note="LRR 20"
689-710 REPEAT /note="LRR 21"
713-734 REPEAT /note="LRR 22"
737-758 REPEAT /note="LRR 23"
772-824 DOMAIN /note="LRRCT"
878-1022 DOMAIN /note="TIR"
1-1041 DISORDER predicted by DISOPRED

MONOMER
1041
pdb_id a1 identity[%]2 description
4qbz A 100.0 TLR8_HUMAN Toll-like receptor 8
7cyn A 43.2 TLR7_HUMAN Toll-like receptor 7
3j0a A 31.2 TLR5_HUMAN Toll-like receptor 5
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1041 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7c76[1] B UN93B_HUMAN Protein unc-93 homolog B1[483 aa] A 33.3
/30.7
21
/23
TLR3_HUMAN Toll-like receptor 3
7cyn[2] C UN93B_HUMAN Protein unc-93 homolog B1[483 aa] A 50.0
/43.2
18
/18
TLR7_HUMAN Toll-like receptor 7
4yeb[5] A LPHN3_MOUSE Latrophilin-3[267 aa] B 10.0
/39.8
10
/22
Q8BGT1_MOUSE Fibronectin leucine rich transmembrane protein 3
6jbu[1] A AGRL3_MOUSE Adhesion G protein-coupled receptor L3[263 aa] B 0.0
/39.2
7
/19
FLRT3_HUMAN Leucine-rich repeat transmembrane protein FLRT3
6htf[1] A BTK_HUMAN Tyrosine-protein kinase BTK[104 aa] B 18.2
/38.0
11
/22
rF10 repebody
4v2c[5] B F1LW30_RAT PROTEIN UNC5D[106 aa] A 28.6
/37.4
14
/14
Q8BLU0_MOUSE FIBRONECTIN LEUCINE RICH TRANSMEMBRANE PROTEIN 2
5ftt[2] A UNC5D_RAT NETRIN RECEPTOR UNC5D[262 aa] B 23.1
/37.4
13
/13
FLRT2_MOUSE LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN FLRT2
5ftt[2] E UNC5D_RAT NETRIN RECEPTOR UNC5D[259 aa] B 28.6
/37.4
7
/10
FLRT2_MOUSE LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN FLRT2
5ftt[5] C AGRL3_MOUSE ADHESION G PROTEIN-COUPLED RECEPTOR L3[365 aa] B 12.5
/37.4
8
/21
FLRT2_MOUSE LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN FLRT2
3zyi[1] B NTNG2_HUMAN NETRIN-G2[303 aa] A 5.6
/37.2
18
/27
LRRC4_HUMAN LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4
1m10[8] A VWF_HUMAN von Willebrand Factor[199 aa] B 11.1
/35.4
9
/26
GP1BA_HUMAN Glycoprotein Ib alpha
6ka7[2] C IGG1_HUMAN Immunoglobulin gamma-1 heavy chain[198 aa] A 25.0
/37.9
8
/19
repebody
3m18[1] B LYSC_CHICK Lysozyme C[127 aa] A 21.4
/36.5
14
/25
C7B6Y3_PETMA Variable lymphocyte receptor A diversity region
6lbx[1] B ERBB2_HUMAN Receptor tyrosine-protein kinase erbB-2[72 aa] A 0.0
/36.5
9
/17
Repebody (Rb-H2)
4bsr[15] C RSPO1_HUMAN R-SPONDIN-1[103 aa] A 4.2
/35.2
24
/24
LGR5_HUMAN LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED R..
4kt1[1] B RSPO1_HUMAN R-spondin-1[90 aa] A 4.8
/34.2
21
/22
LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled r..
4qxf[2] D RSPO1_HUMAN R-spondin-1[79 aa] A 31.8
/36.1
22
/22
LGR4_HUMAN Q4G1L2_EPTBU Leucine-rich repeat-containing G-protein coupled r..
5b4p[2] B CO5_HUMAN C5a anaphylatoxin[72 aa] A 26.7
/35.7
15
/17
repebody
1ook[3] B THRB_HUMAN Human Alpha Thrombin[259 aa] D 8.3
/35.6
12
/22
GPBA_HUMAN Platelet glycoprotein Ib alpha chain precursor
1p8v[2] C THRB_HUMAN Prothrombin[250 aa] A 0.0
/35.4
7
/13
GP1BA_HUMAN Platelet glycoprotein Ib alpha chain
1u0n[1] C BOTB_BOTJA Botrocetin[125 aa] D 50.0
/35.4
4
/7
GP1BA_HUMAN Platelet glycoprotein Ib
3p72[1] B OS1 peptide[11 aa] A 0.0
/35.4
8
/13
GP1BA_HUMAN Platelet glycoprotein Ib alpha chain
6xfq[1] B SLA1_DEIAC Snaclec agglucetin subunit alpha-1[130 aa] A 33.3
/35.4
3
/6
GP1BA_HUMAN Platelet glycoprotein Ib alpha chain
6xfq[1] C SLB2_DEIAC Snaclec agglucetin subunit beta-2[124 aa] A 0.0
/35.4
6
/14
GP1BA_HUMAN Platelet glycoprotein Ib alpha chain
4kng[2] F RNF43_HUMAN E3 ubiquitin-protein ligase RNF43[148 aa] A 44.4
/35.2
9
/12
LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled r..
4ufr[3] B RSPO2_MOUSE R-SPONDIN-2[102 aa] A 7.4
/35.2
27
/27
LGR5_HUMAN LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED R..
6gff[1] A TGFB1_HUMAN Transforming growth factor beta-1[168 aa] I 14.3
/34.3
14
/18
LRC32_HUMAN Leucine-rich repeat-containing protein 32
6gff[1] C TGFB1_HUMAN Transforming growth factor beta-1[209 aa] I 16.7
/34.3
6
/6
LRC32_HUMAN Leucine-rich repeat-containing protein 32
6gff[1] K MHG-8 Fab light chain[212 aa] I 22.2
/34.3
9
/9
LRC32_HUMAN Leucine-rich repeat-containing protein 32
6gff[1] L MHG-8 Fab heavy chain[214 aa] I 16.7
/34.3
12
/12
LRC32_HUMAN Leucine-rich repeat-containing protein 32
3zyj[2] B NTNG1_HUMAN NETRIN-G1[326 aa] A 12.5
/34.0
24
/28
LRC4C_HUMAN LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4C
3oja[1] A Q7Q5N3_ANOGA Leucine-rich Immune Molecule 1[482 aa] B 15.4
/33.3
13
/92
Anopheles Plasmodium-responsive Leucine-rich repea..
5z8y[4] B NRX1B_HUMAN Neurexin-1-beta[178 aa] A 20.0
/33.0
5
/8
LRRT2_HUMAN Leucine-rich repeat transmembrane neuronal protein..
6gff[2] B TGFB1_HUMAN Transforming growth factor beta-1[112 aa] I 0.0
/34.3
1
/1
LRC32_HUMAN Leucine-rich repeat-containing protein 32
6gff[3] D TGFB1_HUMAN Transforming growth factor beta-1[111 aa] I 19.0
/34.3
21
/21
LRC32_HUMAN Leucine-rich repeat-containing protein 32
8c7h[1] A TGFB1_HUMAN Transforming growth factor beta-1[38 aa] E 41.7
/32.6
12
/16
LRC32_HUMAN Transforming growth factor beta activator LRRC32
8c7h[1] C TGFB1_HUMAN Transforming growth factor beta-1[160 aa] E 12.5
/32.6
8
/8
LRC32_HUMAN Transforming growth factor beta activator LRRC32
8c7h[1] F 28G11 Fab heavy chain[182 aa] E 0.0
/32.6
10
/10
LRC32_HUMAN Transforming growth factor beta activator LRRC32
8c7h[1] G 28G11 Fab light chain[173 aa] E 0.0
/32.6
3
/3
LRC32_HUMAN Transforming growth factor beta activator LRRC32
6gff[1] E TGFB1_HUMAN Transforming growth factor beta-1[222 aa] J 53.3
/32.5
15
/20
LRC32_HUMAN Leucine-rich repeat-containing protein 32
6gff[1] G TGFB1_HUMAN Transforming growth factor beta-1[218 aa] J 25.0
/32.5
8
/8
LRC32_HUMAN Leucine-rich repeat-containing protein 32
6gff[1] M MHG-8 Fab light chain[104 aa] J 11.1
/32.5
9
/9
LRC32_HUMAN Leucine-rich repeat-containing protein 32
6gff[1] N MHG-8 Fab heavy chain[118 aa] J 0.0
/32.5
12
/12
LRC32_HUMAN Leucine-rich repeat-containing protein 32
5hyx[1] B PTR-SER-ASN-PRO-GLY-HIS-HIS-PRO-HYP-ARG-HIS-ASN[13.. A 23.3
/32.4
30
/33
Y4265_ARATH Probable LRR receptor-like serine/threonine-protei..
5hz3[1] B ASP-PTR-PRO-LYS-PRO-SER-THR-ARG-PRO-HYP-ARG-HIS-AS.. A 22.6
/32.4
31
/34
Y4265_ARATH Probable LRR receptor-like serine/threonine-protei..
4uip[1] A EGFR_HUMAN EPIDERMAL GROWTH FACTOR RECEPTOR[612 aa] B 13.3
/32.4
15
/22
E0ACT6_LISMN Q4G1L3_EPTBU REPEBODY (RAC1)
5gij[2] B CLE41_ARATH Peptide from CLAVATA3/ESR (CLE)-related protein 41.. A 14.3
/33.6
7
/24
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
5jfi[2] B A0A178VDH8_ARATH CLE41[12 aa] A 28.6
/32.3
7
/25
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
5gqr[1] B TDIF[12 aa] A 16.7
/32.3
6
/22
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
5gqr[1] C SERK2_ARATH Somatic embryogenesis receptor kinase 2[185 aa] A 9.1
/32.3
11
/12
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
4bv4[1] A SPZ_DROME PROTEIN SPAETZLE C-106[66 aa] C 13.3
/32.0
15
/18
TOLL_DROME Q4G1L2_EPTBU PROTEIN TOLL, VARIABLE LYMPHOCYTE RECEPTOR B CHIME..
4oqt[2] B Light Chain of Li81 Fab, kappa 3[214 aa] A 12.5
/31.9
8
/8
LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain..
4oqt[2] C Heavy Chain of Li81 Fab, VH3-23[221 aa] A 20.0
/31.9
5
/5
LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain..
4oqt[1] C Heavy Chain of Li81 Fab, VH3-23[221 aa] A 50.0
/31.9
4
/7
LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain..
7wrq[1] B IBP3_HUMAN Insulin-like growth factor-binding protein 3[167 a.. A 27.3
/31.9
11
/18
ALS_HUMAN Insulin-like growth factor-binding protein complex..
7wrq[1] C IGF1_HUMAN Isoform 3 of Insulin-like growth factor I[65 aa] A 0.0
/31.9
9
/10
ALS_HUMAN Insulin-like growth factor-binding protein complex..
4rca[1] A PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta[3.. B 20.8
/29.6
24
/24
SLIK1_HUMAN SLIT and NTRK-like protein 1
5xnp[2] C PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta[2.. A 33.3
/33.2
6
/23
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xwt[2] A PTPRD_MOUSE Receptor-type tyrosine-protein phosphatase delta[3.. B 33.3
/32.6
6
/23
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xwu[2] A PTPRD_MOUSE Receptor-type tyrosine-protein phosphatase delta[2.. B 50.0
/31.9
2
/23
LRFN1_MOUSE Leucine-rich repeat and fibronectin type III domai..
3kj4[2] A Fab fragment 1D9 light chain[219 aa] C 40.0
/31.8
5
/5
RTN4R_RAT Reticulon-4 receptor
3kj4[2] B Fab fragment 1D9 heavy chain[219 aa] C 21.4
/31.8
14
/15
RTN4R_RAT Reticulon-4 receptor
6s6q[2] C CIF2_ARATH Protein CASPARIAN STRIP INTEGRITY FACTOR 2[21 aa] A 17.6
/31.5
34
/42
GSO1_ARATH LRR receptor-like serine/threonine-protein kinase ..
4j4l[1] C IL6_HUMAN Interleukin-6[155 aa] A 23.5
/31.5
17
/23
A4L9V2_LISMN Q4G1L3_EPTBU Internalin B,REPEAT MODULES,Variable lymphocyte re..
4j4l[1] D IL6_HUMAN Interleukin-6[166 aa] B 16.7
/31.4
18
/25
A4L9V2_LISMN Q4G1L3_EPTBU Internalin B,REPEAT MODULES,Variable lymphocyte re..
7drb[3] A Q30BZ2_PHYSO Cell 12A endoglucanase[222 aa] B 8.3
/29.4
12
/32
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7drc[1] C Brassinosteroid insensitive 1-associated receptor .. B 31.2
/31.3
16
/17
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
5gs0[2] B light chain (anti-TLR3)[107 aa] A 0.0
/31.1
9
/10
TLR3_HUMAN Toll-like receptor 3
5gs0[2] C heavy chain (anti-TLR3)[122 aa] A 9.1
/31.1
11
/11
TLR3_HUMAN Toll-like receptor 3
7wvf[1] E mAb12[228 aa] A 0.0
/31.1
11
/12
TLR3_HUMAN Toll-like receptor 3
3rg1[7] I A4IFT3_BOVIN LY86 protein[138 aa] A 26.3
/31.2
19
/22
A6QNK7_BOVIN CD180 molecule
3rg1[7] J A4IFT3_BOVIN LY86 protein[136 aa] A 25.0
/31.2
8
/9
A6QNK7_BOVIN CD180 molecule
7yco[1] A SPIKE_SARS2 Spike protein S1[196 aa] B 18.2
/31.0
11
/24
Repebody (A6)
8h6f[1] A SPIKE_SARS2 Spike glycoprotein[1036 aa] D 0.0
/31.0
6
/9
Repebody (A6)
8h6f[1] C SPIKE_SARS2 Spike glycoprotein[1036 aa] E 50.0
/31.0
4
/9
Repebody (A6)
8h6f[1] B SPIKE_SARS2 Spike glycoprotein[1038 aa] F 25.0
/31.0
4
/6
Repebody (A6)
5gs2[1] B anti-repebody[226 aa] D 25.0
/30.9
12
/17
repebody
5gs2[1] C anti-MBP[231 aa] D 0.0
/30.9
2
/2
repebody
3ulu[2] B Fab15 light chain[214 aa] A 40.0
/31.1
10
/10
TLR3_HUMAN Toll-like receptor 3
3ulu[2] C Fab15 heavy chain[225 aa] A 35.3
/31.1
17
/17
TLR3_HUMAN Toll-like receptor 3
3ulu[2] D Fab12 light chain[210 aa] A 0.0
/31.1
7
/8
TLR3_HUMAN Toll-like receptor 3
3ulu[2] E Fab12 heavy chain[224 aa] A 0.0
/31.1
9
/9
TLR3_HUMAN Toll-like receptor 3
3ulu[2] F Fab1068 light chain[215 aa] A 0.0
/31.1
8
/8
TLR3_HUMAN Toll-like receptor 3
3ulu[2] G Fab1068 heavy chain[217 aa] A 0.0
/31.1
11
/13
TLR3_HUMAN Toll-like receptor 3
7b1b[1] B Q16J57_AEDAE AAEL013433-PA[99 aa] A 0.0
/30.7
2
/4
A0A6I8TEX2_AEDAE Toll-like receptor
7b1b[2] C Q16J57_AEDAE AAEL013433-PA[92 aa] A 0.0
/30.7
2
/10
A0A6I8TEX2_AEDAE Toll-like receptor
7e5b[2] D ASC_HUMAN Apoptosis-associated speck-like protein containing.. A 5.0
/30.5
20
/22
Repebody (Rb-B7)
3t6q[2] B LY86_MOUSE Lymphocyte antigen 86[139 aa] A 22.7
/30.0
22
/25
CD180_MOUSE CD180 antigen
3t6q[2] D LY86_MOUSE Lymphocyte antigen 86[139 aa] A 18.2
/30.0
11
/11
CD180_MOUSE CD180 antigen
3fxi[4] C LY96_HUMAN Lymphocyte antigen 96[140 aa] A 30.4
/31.3
23
/27
TLR4_HUMAN Toll-like receptor 4
3fxi[4] D LY96_HUMAN Lymphocyte antigen 96[140 aa] A 14.3
/31.3
14
/14
TLR4_HUMAN Toll-like receptor 4
3ula[2] D LY96_HUMAN Lymphocyte antigen 96[140 aa] A 33.3
/30.8
3
/10
TLR4_HUMAN Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
3b2d[2] C LY86_HUMAN Lymphocyte antigen 86[139 aa] A 28.6
/29.9
21
/22
CD180_HUMAN CD180 antigen
3b2d[2] D LY86_HUMAN Lymphocyte antigen 86[139 aa] A 20.0
/29.9
10
/10
CD180_HUMAN CD180 antigen
5d3i[1] B Q2G0X7_STAA8 Staphylococcal Superantigen-Like protein 3[190 aa].. A 25.0
/29.7
16
/16
TLR2_MOUSE Toll-like receptor 2
4bv4[3] B SPZ_DROME PROTEIN SPAETZLE C-106[68 aa] C 8.3
/32.0
12
/27
TOLL_DROME Q4G1L2_EPTBU PROTEIN TOLL, VARIABLE LYMPHOCYTE RECEPTOR B CHIME..
4lxr[2] B SPZ_DROME Protein spaetzle C-106[64 aa] A 29.4
/29.3
17
/20
TOLL_DROME Protein toll
2z64[1] B LY96_MOUSE Lymphocyte antigen 96[135 aa] A 22.2
/28.8
18
/26
TLR4_MOUSE Toll-like receptor 4
3vq1[4] B LY96_MOUSE Lymphocyte antigen 96[135 aa] A 17.4
/28.9
23
/30
TLR4_MOUSE Toll-like receptor 4
3vq1[4] D LY96_MOUSE Lymphocyte antigen 96[135 aa] A 10.0
/28.9
10
/10
TLR4_MOUSE Toll-like receptor 4
5ijb[4] B LY96_MOUSE Lymphocyte antigen 96[136 aa] A 18.2
/29.1
22
/27
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
5ijc[4] D LY96_MOUSE Lymphocyte antigen 96[136 aa] A 22.2
/29.7
9
/9
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
5ijd[2] C LY96_MOUSE Lymphocyte antigen 96[137 aa] A 11.1
/29.2
9
/9
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
7mlm[2] B LY96_MOUSE Lymphocyte antigen 96[136 aa] A 19.0
/29.2
21
/28
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
7yo3[1] A A0A1W2PRB0_HUMAN Calcium-activated potassium channel subunit alpha-.. B 25.0
/29.0
4
/27
LRC26_HUMAN Leucine-rich repeat-containing protein 26
3a79[1] B TLR6_MOUSE Q4G1L3_EPTBU Toll-like receptor 6, Variable lymphocyte receptor.. A 28.6
/29.0
14
/15
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
3a79[1] C Pam2CSK4[6 aa] A 37.5
/29.0
8
/8
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
6bxa[2] A F8W3J5_DANRE Q4G1L2_EPTBU Toll-like receptor 5b, Variable lymphocyte recepto.. C 16.7
/27.5
18
/22
Variable Lymphocyte Receptor 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
1041 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5gmf[6] G RNA (5'-R(P*UP*UP*UP*U)-3') A 0.0
/43.1
1
/1
B3Y653_MACMU Toll-like receptor 7
5gmf[6] H RNA (5'-R(P*UP*UP*UP*U)-3') A 9.1
/43.1
22
/22
B3Y653_MACMU Toll-like receptor 7
5zsa[2] C RNA (5'-R(P*UP*UP*UP*U)-3') A 9.1
/43.1
22
/22
B3Y653_MACMU Toll-like receptor 7
5zsa[2] D RNA (5'-R(P*UP*UP*UP*U)-3') A 0.0
/43.1
1
/1
B3Y653_MACMU Toll-like receptor 7
5zsb[1] C RNA (5'-R(*AP*UP*UP*AP*A)-3') A 33.3
/43.1
3
/3
B3Y653_MACMU Toll-like receptor 7
5zsb[1] C RNA (5'-R(*AP*UP*UP*AP*A)-3') B 10.5
/43.2
19
/21
B3Y653_MACMU Toll-like receptor 7
5zsb[3] D RNA (5'-R(*AP*UP*UP*AP*A)-3') A 9.5
/43.1
21
/21
B3Y653_MACMU Toll-like receptor 7
5zsb[2] D RNA (5'-R(*AP*UP*UP*AP*A)-3') B 0.0
/43.2
1
/1
B3Y653_MACMU Toll-like receptor 7
5zsd[2] C RNA (5'-R(P*UP*UP*GP*A)-3') A 0.0
/43.1
1
/1
B3Y653_MACMU Toll-like receptor 7
5zsd[4] D RNA (5'-R(P*UP*UP*GP*A)-3') A 9.5
/43.1
21
/21
B3Y653_MACMU Toll-like receptor 7
5zse[4] C RNA (5'-R(*GP*UP*CP*CP*C)-3') A 25.0
/43.1
4
/4
B3Y653_MACMU Toll-like receptor 7
5zse[4] D RNA (5'-R(*GP*UP*CP*CP*C)-3') A 9.5
/43.1
21
/22
B3Y653_MACMU Toll-like receptor 7
5zsc[2] C RNA (5'-R(P*UP*UP*CP*A)-3') A 50.0
/43.1
2
/2
B3Y653_MACMU Toll-like receptor 7
5zsc[2] D RNA (5'-R(P*UP*UP*CP*A)-3') A 9.1
/43.1
22
/22
B3Y653_MACMU Toll-like receptor 7
5y3j[2] D DNA (5'-D(*TP*CP*GP*CP*AP*C)-3') A 50.0
/37.7
8
/8
TLR9_HORSE Toll-like receptor 9
5y3k[2] C DNA (5'-D(*GP*CP*GP*CP*AP*C)-3') A 44.4
/37.7
9
/9
TLR9_HORSE Toll-like receptor 9
5y3l[2] C DNA (5'-D(*CP*CP*GP*CP*AP*C)-3') A 50.0
/37.7
8
/8
TLR9_HORSE Toll-like receptor 9
5y3m[1] B DNA (5'-D(*TP*CP*GP*T)-3') A 28.6
/37.3
14
/14
TLR9_BOVIN Toll-like receptor 9
5y3m[1] B DNA (5'-D(*TP*CP*GP*T)-3') F 50.0
/37.6
8
/8
TLR9_BOVIN Toll-like receptor 9
5y3m[1] C DNA (5'-D(*TP*CP*GP*T)-3') A 50.0
/37.3
8
/8
TLR9_BOVIN Toll-like receptor 9
5y3m[1] C DNA (5'-D(*TP*CP*GP*T)-3') F 28.6
/37.6
14
/14
TLR9_BOVIN Toll-like receptor 9
5y3m[2] D DNA (5'-D(P*GP*GP*CP*GP*TP*T)-3') A 33.3
/37.3
3
/3
TLR9_BOVIN Toll-like receptor 9
5y3m[2] E DNA (5'-D(P*GP*GP*CP*GP*TP*T)-3') A 20.0
/37.3
15
/15
TLR9_BOVIN Toll-like receptor 9
3wpc[2] C DNA (5'-D(*CP*AP*TP*GP*AP*CP*GP*TP*TP*CP*CP*T)-3').. A 20.0
/37.4
5
/5
Q2EEY0_HORSE Toll-like receptor 9
3wpc[2] D DNA (5'-D(*CP*AP*TP*GP*AP*CP*GP*TP*TP*CP*CP*T)-3').. A 15.4
/37.4
26
/26
Q2EEY0_HORSE Toll-like receptor 9
3wpe[2] B DNA (5'-D(*CP*AP*TP*GP*AP*CP*GP*TP*TP*CP*CP*T)-3').. A 21.4
/37.4
14
/14
TLR9_BOVIN Toll-like receptor 9
3wpe[2] B DNA (5'-D(*CP*AP*TP*GP*AP*CP*GP*TP*TP*CP*CP*T)-3').. A 33.3
/37.4
3
/3
TLR9_BOVIN Toll-like receptor 9
3wpd[1] B DNA (5'-D(*CP*CP*TP*GP*GP*AP*TP*GP*GP*G)-3') A 20.7
/37.3
29
/29
Q2EEY0_HORSE Toll-like receptor 9
3wpi[1] B DNA (5'-D(*CP*CP*TP*CP*AP*AP*TP*AP*GP*GP*GP*TP*GP*.. A 20.8
/37.0
24
/24
TLR9_MOUSE Toll-like receptor 9
3wph[1] B DNA (5'-D(*CP*CP*TP*GP*GP*AP*TP*GP*GP*GP*AP*A)-3').. A 24.3
/36.9
37
/37
TLR9_MOUSE Toll-like receptor 9
3wpg[1] B DNA (5'-D(*CP*CP*TP*GP*GP*AP*TP*GP*GP*GP*AP*A)-3').. A 25.7
/36.9
35
/35
TLR9_MOUSE Toll-like receptor 9
5y3j[6] C DNA (5'-D(*AP*GP*GP*CP*GP*TP*TP*TP*TP*T)-3') A 8.7
/37.7
23
/23
TLR9_HORSE Toll-like receptor 9
5zln[2] C DNA (5'-D(*AP*GP*GP*CP*GP*TP*TP*TP*TP*T)-3') A 19.0
/35.9
21
/21
TLR9_MOUSE Toll-like receptor 9
5zln[2] D DNA (5'-D(*AP*GP*GP*CP*GP*TP*TP*TP*TP*T)-3') A 20.0
/35.9
5
/5
TLR9_MOUSE Toll-like receptor 9
5zln[2] E DNA (5'-D(*TP*CP*GP*C)-3') A 30.8
/35.9
13
/13
TLR9_MOUSE Toll-like receptor 9
5zln[2] F DNA (5'-D(*TP*CP*GP*C)-3') A 37.5
/35.9
8
/8
TLR9_MOUSE Toll-like receptor 9
7das[2] C RNA component of mitochondrial RNAase P (Rmrp), RN.. A 0.0
/35.4
5
/20
TLR3_MOUSE Toll-like receptor 3
7da7[2] C RNA component of mitochondrial RNAase P (Rmrp), RN.. A 0.0
/35.3
6
/21
TLR3_MOUSE Toll-like receptor 3
3ciy[1] A 46-MER C 0.0
/35.7
3
/14
TLR3_MOUSE Toll-like receptor 3
3ciy[1] A 46-MER D 14.3
/35.1
7
/12
TLR3_MOUSE Toll-like receptor 3
3ciy[1] B 46-MER C 0.0
/35.7
6
/14
TLR3_MOUSE Toll-like receptor 3
3ciy[1] B 46-MER D 0.0
/35.1
4
/14
TLR3_MOUSE Toll-like receptor 3
7wm4[2] E RNA (81-MER) A 0.0
/35.7
2
/10
TLR3_MOUSE Toll-like receptor 3
7wm4[2] E RNA (81-MER) B 0.0
/35.1
5
/12
TLR3_MOUSE Toll-like receptor 3
7wm4[2] F RNA (81-MER) A 0.0
/35.7
4
/11
TLR3_MOUSE Toll-like receptor 3
7wm4[2] F RNA (81-MER) B 0.0
/35.1
3
/14
TLR3_MOUSE Toll-like receptor 3
4z0c[2] C DNA (5'-R(P*AP*CP*GP*GP*AP*AP*AP*GP*AP*CP*CP*CP*C).. A 21.1
/31.5
19
/25
TLR13_MOUSE Toll-like receptor 13
4z0c[2] D DNA (5'-R(P*AP*CP*GP*GP*AP*AP*AP*GP*AP*CP*CP*CP*C).. A 22.2
/31.5
9
/11
TLR13_MOUSE Toll-like receptor 13
7wv3[4] E RNA (80-MER) A 35.7
/30.7
14
/14
TLR3_HUMAN Toll-like receptor 3
7wv3[4] E RNA (80-MER) B 14.3
/30.7
14
/14
TLR3_HUMAN Toll-like receptor 3
7wv3[4] F RNA (80-MER) A 0.0
/30.7
7
/7
TLR3_HUMAN Toll-like receptor 3
7wv3[4] F RNA (80-MER) B 30.8
/30.7
13
/13
TLR3_HUMAN Toll-like receptor 3
7wv5[8] C RNA (46-MER) A 20.0
/31.1
15
/15
TLR3_HUMAN Toll-like receptor 3
7wv5[8] D RNA (46-MER) A 26.7
/31.1
15
/15
TLR3_HUMAN Toll-like receptor 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1041 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3wn4[2] E D87
2-butylfuro[2,3-c]quinolin-4-amine[18 atoms]
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
4qbz[2] O D80
2-butyl[1,3]oxazolo[4,5-c]quinolin-4-amine[18 atom..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
4qbz[2] P D80
2-butyl[1,3]oxazolo[4,5-c]quinolin-4-amine[18 atom..
A 100.0
/100.0
8
/8
TLR8_HUMAN Toll-like receptor 8
4qc0[2] J XG1
2-butyl-2H-pyrazolo[3,4-c]quinolin-4-amine[18 atom..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
4qc0[2] K XG1
2-butyl-2H-pyrazolo[3,4-c]quinolin-4-amine[18 atom..
A 100.0
/100.0
6
/6
TLR8_HUMAN Toll-like receptor 8
4r07[14] Q URI
URIDINE[17 atoms]
A 100.0
/100.0
7
/7
TLR8_HUMAN Toll-like receptor 8
4r07[14] X URI
URIDINE[17 atoms]
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
4r07[8] R UCG
3'-O-[(R)-{[(2R,3aR,4R,6R,6aR)-6-(2-amino-6-oxo-1,..
A 100.0
/100.0
15
/15
TLR8_HUMAN Toll-like receptor 8
4r09[4] Q 06S
O-[(2R,3S,4R,5R)-5-(2-amino-6-oxo-3,6-dihydro-9H-p..
A 100.0
/100.0
15
/15
TLR8_HUMAN Toll-like receptor 8
4r09[4] R UPT
1-[(2R,3aR,4R,6R,6aR)-2-hydroxy-6-(hydroxymethyl)-..
A 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
4r09[4] V UPT
1-[(2R,3aR,4R,6R,6aR)-2-hydroxy-6-(hydroxymethyl)-..
A 100.0
/100.0
3
/3
TLR8_HUMAN Toll-like receptor 8
4r6a[2] M HB2
1-(4-amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
4r6a[2] N HB2
1-(4-amino-2-butyl-1H-imidazo[4,5-c]quinolin-1-yl)..
A 100.0
/100.0
11
/11
TLR8_HUMAN Toll-like receptor 8
5awa[2] E M8D
5-[[3-(aminomethyl)phenyl]methyl]-3-pentyl-quinoli..
A 100.0
/100.0
7
/7
TLR8_HUMAN Toll-like receptor 8
5awa[2] E M8D
5-[[3-(aminomethyl)phenyl]methyl]-3-pentyl-quinoli..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
5awb[2] E M0A
1-[[3-(aminomethyl)phenyl]methyl]-2-butyl-imidazo[..
A 100.0
/100.0
9
/9
TLR8_HUMAN Toll-like receptor 8
5awb[2] E M0A
1-[[3-(aminomethyl)phenyl]methyl]-2-butyl-imidazo[..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
5awc[4] T M4D
5-(4-azanylbutyl)-3-pentyl-quinolin-2-amine[21 ato..
A 100.0
/100.0
6
/6
TLR8_HUMAN Toll-like receptor 8
5awc[4] U M4D
5-(4-azanylbutyl)-3-pentyl-quinolin-2-amine[21 ato..
A 100.0
/100.0
9
/9
TLR8_HUMAN Toll-like receptor 8
5az5[4] Q MBL
1-pentyl-4-phenyl-imidazol-2-amine[17 atoms]
A 100.0
/100.0
7
/7
TLR8_HUMAN Toll-like receptor 8
5az5[4] U MBL
1-pentyl-4-phenyl-imidazol-2-amine[17 atoms]
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
5wyx[2] M CU8
7-(3-methylphenyl)pyrazolo[1,5-a]pyrimidine-3-carb..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
5wyx[2] N CU8
7-(3-methylphenyl)pyrazolo[1,5-a]pyrimidine-3-carb..
A 100.0
/100.0
11
/11
TLR8_HUMAN Toll-like receptor 8
5wyz[2] I 7VF
4-(3-methyl-4-oxidanyl-phenyl)quinolin-7-ol[19 ato..
A 100.0
/100.0
6
/6
TLR8_HUMAN Toll-like receptor 8
5wyz[2] M 7VF
4-(3-methyl-4-oxidanyl-phenyl)quinolin-7-ol[19 ato..
A 100.0
/100.0
11
/11
TLR8_HUMAN Toll-like receptor 8
5z14[2] I 7VC
4-(7-methoxyquinolin-4-yl)-2-methyl-phenol[20 atom..
A 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
5z14[2] L 7VC
4-(7-methoxyquinolin-4-yl)-2-methyl-phenol[20 atom..
A 100.0
/100.0
6
/6
TLR8_HUMAN Toll-like receptor 8
5z15[2] I 7VL
4-(7-chloranylquinolin-4-yl)-2-methyl-phenol[19 at..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
5z15[2] N 7VL
4-(7-chloranylquinolin-4-yl)-2-methyl-phenol[19 at..
A 100.0
/100.0
9
/9
TLR8_HUMAN Toll-like receptor 8
6kya[2] I DY3
3-[5-methylsulfanyl-4-(3,4,5-trimethylphenyl)-1,2,..
A 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
6kya[2] N DY3
3-[5-methylsulfanyl-4-(3,4,5-trimethylphenyl)-1,2,..
A 100.0
/100.0
7
/7
TLR8_HUMAN Toll-like receptor 8
6ty5[1] O O0W
5-methyl-7-(7-methyl-2-piperidin-4-yl-indazol-5-yl..
B 100.0
/100.0
11
/11
TLR8_HUMAN Toll-like receptor 8
6ty5[1] V O0W
5-methyl-7-(7-methyl-2-piperidin-4-yl-indazol-5-yl..
B 100.0
/100.0
8
/8
TLR8_HUMAN Toll-like receptor 8
6v9u[2] AA QSM
2-(3,4-dimethoxyphenyl)-5-(piperidin-4-yl)-3-(prop..
A 100.0
/100.0
6
/6
TLR8_HUMAN Toll-like receptor 8
6v9u[2] R QSM
2-(3,4-dimethoxyphenyl)-5-(piperidin-4-yl)-3-(prop..
A 100.0
/100.0
9
/9
TLR8_HUMAN Toll-like receptor 8
6wml[4] GA U57
(2R)-2-[(2-amino-7-fluoropyrido[3,2-d]pyrimidin-4-..
A 100.0
/100.0
7
/7
TLR8_HUMAN Toll-like receptor 8
6wml[4] X U57
(2R)-2-[(2-amino-7-fluoropyrido[3,2-d]pyrimidin-4-..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
6wml[2] Q MAN
alpha-D-mannopyranose[11 atoms]
A 100.0
/100.0
2
/2
TLR8_HUMAN Toll-like receptor 8
6zjz[2] N QLH
5-[(3~{R},5~{S})-3-azanyl-5-(trifluoromethyl)piper..
A 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
6zjz[2] S QLH
5-[(3~{R},5~{S})-3-azanyl-5-(trifluoromethyl)piper..
A 100.0
/100.0
6
/6
TLR8_HUMAN Toll-like receptor 8
7crf[2] I GD0
1-[2-(ethoxymethyl)-4-iodanyl-5-phenyl-imidazol-1-..
A 100.0
/100.0
7
/7
TLR8_HUMAN Toll-like receptor 8
7crf[2] U GD0
1-[2-(ethoxymethyl)-4-iodanyl-5-phenyl-imidazol-1-..
A 100.0
/100.0
7
/7
TLR8_HUMAN Toll-like receptor 8
7r52[2] O I6A
5-methoxy-6-pyridin-4-yl-1~{H}-indole[17 atoms]
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
7r52[2] V I6A
5-methoxy-6-pyridin-4-yl-1~{H}-indole[17 atoms]
A 100.0
/100.0
9
/9
TLR8_HUMAN Toll-like receptor 8
7r53[2] O I5N
5-cyclopropyl-6-(2,6-dimethylpyridin-4-yl)-~{N}-[(..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
7r53[2] P I5N
5-cyclopropyl-6-(2,6-dimethylpyridin-4-yl)-~{N}-[(..
A 100.0
/100.0
12
/12
TLR8_HUMAN Toll-like receptor 8
7r54[2] O I5B
(5-methoxy-6-pyridin-4-yl-1~{H}-indazol-3-yl)-(4-m..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
7r54[2] P I5B
(5-methoxy-6-pyridin-4-yl-1~{H}-indazol-3-yl)-(4-m..
A 100.0
/100.0
9
/9
TLR8_HUMAN Toll-like receptor 8
7rc9[2] P RQY
2-(2,6-dimethylpyridin-4-yl)-5-(piperidin-4-yl)-3-..
A 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
7rc9[2] X RQY
2-(2,6-dimethylpyridin-4-yl)-5-(piperidin-4-yl)-3-..
A 100.0
/100.0
6
/6
TLR8_HUMAN Toll-like receptor 8
7ytp[2] N JRI
(2R,6R)-4-(8-cyanoquinolin-5-yl)-N-[(3S,4R)-4-fluo..
A 25.0
/44.2
8
/8
B3Y653_MACMU Toll-like receptor 7
7ytp[2] T JRI
(2R,6R)-4-(8-cyanoquinolin-5-yl)-N-[(3S,4R)-4-fluo..
A 50.0
/44.2
4
/4
B3Y653_MACMU Toll-like receptor 7
7ytx[2] I JRI
(2R,6R)-4-(8-cyanoquinolin-5-yl)-N-[(3S,4R)-4-fluo..
A 100.0
/100.0
12
/12
TLR8_HUMAN Toll-like receptor 8
7ytx[2] S JRI
(2R,6R)-4-(8-cyanoquinolin-5-yl)-N-[(3S,4R)-4-fluo..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
8pfi[2] O YHG
(3~{S})-~{N}-[4-[[5-(1,6-dimethylpyrazolo[3,4-b]py..
A 100.0
/100.0
13
/13
TLR8_HUMAN Toll-like receptor 8
8pfi[2] P YHG
(3~{S})-~{N}-[4-[[5-(1,6-dimethylpyrazolo[3,4-b]py..
A 100.0
/100.0
6
/6
TLR8_HUMAN Toll-like receptor 8
5gmg[2] J SDL
2-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-(hydroxyme..
A 50.0
/43.6
6
/6
B3Y653_MACMU Toll-like receptor 7
5gmg[2] K SDL
2-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-(hydroxyme..
A 50.0
/43.6
6
/6
B3Y653_MACMU Toll-like receptor 7
8s9h[2] N ZWV
(3S)-3-{[5-amino-1-({3-methoxy-5-[1-(oxan-4-yl)pip..
A 50.0
/43.4
6
/6
G8E2R2_MACMU Toll-like receptor 7
8s9h[2] W ZWV
(3S)-3-{[5-amino-1-({3-methoxy-5-[1-(oxan-4-yl)pip..
A 33.3
/43.4
9
/9
G8E2R2_MACMU Toll-like receptor 7
8tty[2] N QEC
N~7~-butyl-2-({4-[(cyclobutylamino)methyl]-2-metho..
A 50.0
/43.4
6
/6
G8E2R2_MACMU Toll-like receptor 7
8tty[2] V QEC
N~7~-butyl-2-({4-[(cyclobutylamino)methyl]-2-metho..
A 62.5
/43.4
8
/8
G8E2R2_MACMU Toll-like receptor 7
6lw1[2] C EX3
2-ethoxy-8-(5-fluoranylpyridin-3-yl)-6-methyl-9-[[..
A 41.7
/43.3
12
/12
B3Y653_MACMU Toll-like receptor 7
6lw1[2] D EX3
2-ethoxy-8-(5-fluoranylpyridin-3-yl)-6-methyl-9-[[..
A 75.0
/43.3
4
/4
B3Y653_MACMU Toll-like receptor 7
6lvx[2] D EWL
6-azanyl-2-butoxy-9-(phenylmethyl)-7H-purin-8-one[..
A 50.0
/43.3
6
/6
B3Y653_MACMU Toll-like receptor 7
6lvx[2] P EWL
6-azanyl-2-butoxy-9-(phenylmethyl)-7H-purin-8-one[..
A 57.1
/43.3
7
/7
B3Y653_MACMU Toll-like receptor 7
6lvy[2] E EWU
6-azanyl-2-(2-methoxyethoxy)-9-(phenylmethyl)-7H-p..
A 50.0
/43.3
6
/6
B3Y653_MACMU Toll-like receptor 7
6lvy[2] S EWU
6-azanyl-2-(2-methoxyethoxy)-9-(phenylmethyl)-7H-p..
A 50.0
/43.3
6
/6
B3Y653_MACMU Toll-like receptor 7
1gwb[1] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/35.6
1
/1
GPBA_HUMAN PLATELET GLYCOPROTEIN IB ALPHA CHAIN
1gwb[383] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/35.6
2
/2
GPBA_HUMAN PLATELET GLYCOPROTEIN IB ALPHA CHAIN
1ook[4] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 0.0
/35.6
3
/3
GPBA_HUMAN Platelet glycoprotein Ib alpha chain precursor
1xcd[5] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/32.3
1
/1
PGS2_BOVIN Decorin
1ziw[173] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/31.3
2
/2
TLR3_HUMAN Toll-like receptor 3
2z64[5] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/28.8
3
/3
TLR4_MOUSE Toll-like receptor 4
3a79[5] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 75.0
/29.0
4
/4
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
3fxi[2] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/31.3
2
/2
TLR4_HUMAN Toll-like receptor 4
3o6n[3] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/33.3
1
/1
APL1
3vq1[149] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/28.9
3
/3
TLR4_MOUSE Toll-like receptor 4
3w3g[73] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
3w3g[55] M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
3wn4[2] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
7
/7
TLR8_HUMAN Toll-like receptor 8
3wn4[2] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
3wpc[14] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 20.0
/37.4
5
/5
Q2EEY0_HORSE Toll-like receptor 9
3wpf[5] B NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 40.0
/36.3
5
/5
TLR9_MOUSE Toll-like receptor 9
3wpf[2] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/36.3
5
/5
TLR9_MOUSE Toll-like receptor 9
4bv4[41] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/32.0
5
/5
TOLL_DROME Q4G1L2_EPTBU PROTEIN TOLL, VARIABLE LYMPHOCYTE RECEPTOR B CHIME..
4lxr[17] M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/29.3
3
/3
TOLL_DROME Protein toll
4qc0[42] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
4qdh[3] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 25.0
/40.6
4
/4
Q4G1L2_EPTBU TLR9_MOUSE Q4G1L2_EPTBU Variable lymphocyte receptor B, Toll-like receptor..
4qdh[6] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 40.0
/40.6
5
/6
Q4G1L2_EPTBU TLR9_MOUSE Q4G1L2_EPTBU Variable lymphocyte receptor B, Toll-like receptor..
4u7l[3] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 25.0
/28.1
4
/4
LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domai..
4z0c[2] N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/31.5
4
/4
TLR13_MOUSE Toll-like receptor 13
5gmf[48] BA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 16.7
/43.1
6
/6
B3Y653_MACMU Toll-like receptor 7
5gmg[31] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 20.0
/43.6
5
/5
B3Y653_MACMU Toll-like receptor 7
5gmh[26] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/43.2
4
/4
B3Y653_MACMU Toll-like receptor 7
5gr9[1] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 71.4
/32.3
7
/7
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
5gr9[18] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 66.7
/32.3
3
/3
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
5gs0[2] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[15 atoms]..
A 0.0
/31.1
1
/2
TLR3_HUMAN Toll-like receptor 3
5hdh[13] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
4
/4
TLR8_HUMAN Toll-like receptor 8
5ijb[4] M NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/29.1
1
/1
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
5y3m[3] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/37.3
2
/2
TLR9_BOVIN Toll-like receptor 9
5y3m[1] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/37.3
5
/5
TLR9_BOVIN Toll-like receptor 9
5y3m[1] N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
F 25.0
/37.6
4
/4
TLR9_BOVIN Toll-like receptor 9
6jbu[1] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/39.2
1
/1
FLRT3_HUMAN Leucine-rich repeat transmembrane protein FLRT3
6s6q[2] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/31.5
2
/3
GSO1_ARATH LRR receptor-like serine/threonine-protein kinase ..
7c76[1] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/30.7
1
/1
TLR3_HUMAN Toll-like receptor 3
7c77[1] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/36.4
1
/2
TLR3_MOUSE Toll-like receptor 3
7drc[2] T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 50.0
/31.3
2
/2
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7drc[2] U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/31.3
1
/1
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7w3x[1] O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/31.4
2
/2
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7wv3[6] T NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/30.7
3
/3
TLR3_HUMAN Toll-like receptor 3
7wv5[2] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/31.1
1
/1
TLR3_HUMAN Toll-like receptor 3
7wv5[2] R NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/31.1
1
/1
TLR3_HUMAN Toll-like receptor 3
7ytp[2] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/44.2
4
/4
B3Y653_MACMU Toll-like receptor 7
3w3j[2] M C09
2-(ethoxymethyl)-1H-imidazo[4,5-c]quinolin-4-amine..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
3w3j[2] V C09
2-(ethoxymethyl)-1H-imidazo[4,5-c]quinolin-4-amine..
A 100.0
/100.0
7
/7
TLR8_HUMAN Toll-like receptor 8
5zsi[2] J C09
2-(ethoxymethyl)-1H-imidazo[4,5-c]quinolin-4-amine..
A 50.0
/43.2
6
/6
B3Y653_MACMU Toll-like receptor 7
5zsi[2] R C09
2-(ethoxymethyl)-1H-imidazo[4,5-c]quinolin-4-amine..
A 80.0
/43.2
5
/5
B3Y653_MACMU Toll-like receptor 7
3w3k[2] I L07
2-propyl[1,3]thiazolo[4,5-c]quinolin-4-amine[17 at..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
3w3k[2] M L07
2-propyl[1,3]thiazolo[4,5-c]quinolin-4-amine[17 at..
A 100.0
/100.0
4
/4
TLR8_HUMAN Toll-like receptor 8
5zsh[2] R L07
2-propyl[1,3]thiazolo[4,5-c]quinolin-4-amine[17 at..
A 50.0
/43.2
6
/6
B3Y653_MACMU Toll-like receptor 7
5zsh[2] S L07
2-propyl[1,3]thiazolo[4,5-c]quinolin-4-amine[17 at..
A 75.0
/43.2
4
/4
B3Y653_MACMU Toll-like receptor 7
3w3l[8] JA RX8
1-[4-amino-2-(ethoxymethyl)-1H-imidazo[4,5-c]quino..
A 100.0
/100.0
9
/9
TLR8_HUMAN Toll-like receptor 8
3w3l[8] KA RX8
1-[4-amino-2-(ethoxymethyl)-1H-imidazo[4,5-c]quino..
A 100.0
/100.0
6
/6
TLR8_HUMAN Toll-like receptor 8
5gmh[2] EA RX8
1-[4-amino-2-(ethoxymethyl)-1H-imidazo[4,5-c]quino..
A 66.7
/43.2
6
/6
B3Y653_MACMU Toll-like receptor 7
5gmh[2] F RX8
1-[4-amino-2-(ethoxymethyl)-1H-imidazo[4,5-c]quino..
A 50.0
/43.2
6
/6
B3Y653_MACMU Toll-like receptor 7
5zsf[2] O 6T0
1-(2-methylpropyl)imidazo[4,5-c]quinolin-4-amine[1..
A 40.0
/43.2
5
/5
B3Y653_MACMU Toll-like receptor 7
5zsf[2] U 6T0
1-(2-methylpropyl)imidazo[4,5-c]quinolin-4-amine[1..
A 50.0
/43.2
4
/4
B3Y653_MACMU Toll-like receptor 7
5zsg[2] M 9K3
1-{4-amino-2-[(ethylamino)methyl]-1H-imidazo[4,5-c..
A 50.0
/43.2
6
/6
G7NS93_MACMU Toll-like receptor 7
5zsg[2] X 9K3
1-{4-amino-2-[(ethylamino)methyl]-1H-imidazo[4,5-c..
A 57.1
/43.2
7
/7
G7NS93_MACMU Toll-like receptor 7
5zsj[2] E 9JR
4-azanyl-2-butoxy-8-[[3-(pyrrolidin-1-ylmethyl)phe..
A 50.0
/43.2
6
/6
B3Y653_MACMU Toll-like receptor 7
5zsj[2] V 9JR
4-azanyl-2-butoxy-8-[[3-(pyrrolidin-1-ylmethyl)phe..
A 42.9
/43.2
7
/7
B3Y653_MACMU Toll-like receptor 7
5zsn[2] GA ACK
2',3'- cyclic AMP [22 atoms]
A 50.0
/43.2
6
/6
B3Y653_MACMU Toll-like receptor 7
5zsn[2] Z ACK
2',3'- cyclic AMP [22 atoms]
A 28.6
/43.2
7
/7
B3Y653_MACMU Toll-like receptor 7
6lvz[2] S EWX
6-azanyl-2-(2-methoxyethoxy)-9-(pyridin-3-ylmethyl..
A 50.0
/43.2
6
/6
B3Y653_MACMU Toll-like receptor 7
6lvz[2] T EWX
6-azanyl-2-(2-methoxyethoxy)-9-(pyridin-3-ylmethyl..
A 50.0
/43.2
8
/8
B3Y653_MACMU Toll-like receptor 7
6lw0[2] CA EX0
2-ethoxy-8-(5-fluoranylpyridin-3-yl)-9-[[4-[[(1S,4..
A 57.1
/43.2
7
/7
B3Y653_MACMU Toll-like receptor 7
6lw0[2] S EX0
2-ethoxy-8-(5-fluoranylpyridin-3-yl)-9-[[4-[[(1S,4..
A 50.0
/43.2
8
/8
B3Y653_MACMU Toll-like receptor 7
8ttz[2] EA QCX
(3S)-3-({5-amino-1-[(2-methoxy-4-{[(oxan-4-yl)amin..
A 50.0
/43.2
6
/6
G8E2R2_MACMU Toll-like receptor 7
5zsl[4] T 9K9
2-amino-9-[(2S,3aR,4R,6R,6aR)-2-hydroxy-6-(hydroxy..
A 50.0
/43.0
6
/6
B3Y653_MACMU Toll-like receptor 7
5zsl[4] U 9K9
2-amino-9-[(2S,3aR,4R,6R,6aR)-2-hydroxy-6-(hydroxy..
A 37.5
/43.0
8
/8
B3Y653_MACMU Toll-like receptor 7
5awd[2] E IDQ
1-[[4-(aminomethyl)phenyl]methyl]-2-butyl-imidazo[..
A 100.0
/100.0
9
/9
TLR8_HUMAN Toll-like receptor 8
5awd[2] E IDQ
1-[[4-(aminomethyl)phenyl]methyl]-2-butyl-imidazo[..
A 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
5zsa[10] P IDQ
1-[[4-(aminomethyl)phenyl]methyl]-2-butyl-imidazo[..
A 50.0
/43.1
6
/6
B3Y653_MACMU Toll-like receptor 7
5zsa[10] Y IDQ
1-[[4-(aminomethyl)phenyl]methyl]-2-butyl-imidazo[..
A 62.5
/43.1
8
/8
B3Y653_MACMU Toll-like receptor 7
5gmf[4] Y GMP
GUANOSINE[20 atoms]
A 50.0
/43.1
6
/6
B3Y653_MACMU Toll-like receptor 7
5gmf[4] Z GMP
GUANOSINE[20 atoms]
A 60.0
/43.1
5
/5
B3Y653_MACMU Toll-like receptor 7
6if5[2] FA 23G
GUANOSINE-5'-PHOSPHATE-2',3'-CYCLIC PHOSPHATE [23 ..
A 50.0
/43.2
6
/6
B3Y653_MACMU Toll-like receptor 7
6if5[2] GA 23G
GUANOSINE-5'-PHOSPHATE-2',3'-CYCLIC PHOSPHATE [23 ..
A 37.5
/43.2
8
/8
B3Y653_MACMU Toll-like receptor 7
3cig[1] K FUC
alpha-L-fucopyranose[11 atoms]
A 0.0
/36.3
1
/1
TLR3_MOUSE Toll-like receptor 3
7la8[2] E BTN
BIOTIN[16 atoms]
A 50.0
/35.1
2
/5
O6 variable lymphocyte receptor
7ylg[2] B GSH
GLUTATHIONE[20 atoms]
A 30.0
/32.8
10
/10
H2D5F4_CHICK Toll-like receptor 2
7ylg[2] B GSH
GLUTATHIONE[20 atoms]
A 0.0
/32.8
1
/1
H2D5F4_CHICK Toll-like receptor 2
3kj4[2] I NDG
2-acetamido-2-deoxy-alpha-D-glucopyranose[14 atoms..
C 50.0
/31.8
4
/4
RTN4R_RAT Reticulon-4 receptor
3fxi[2] N FTT
3-HYDROXY-TETRADECANOIC ACID[16 atoms]
A 0.0
/31.3
1
/1
TLR4_HUMAN Toll-like receptor 4
3fxi[2] Y FTT
3-HYDROXY-TETRADECANOIC ACID[16 atoms]
A 0.0
/31.3
4
/4
TLR4_HUMAN Toll-like receptor 4
3ula[2] I E55
3-O-DECYL-2-DEOXY-6-O-{2-DEOXY-3-O-[(3R)-3-METHOXY..
A 100.0
/30.8
1
/6
TLR4_HUMAN Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
2a0z[1] M GLC
alpha-D-glucopyranose[12 atoms]
A 40.0
/30.7
5
/5
TLR3_HUMAN Toll-like receptor 3
2a0z[1] N GLC
alpha-D-glucopyranose[12 atoms]
A 50.0
/30.7
4
/4
TLR3_HUMAN Toll-like receptor 3
4g8a[2] P KDO
3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid[15..
A 0.0
/30.0
2
/2
TLR4_HUMAN Toll-like receptor 4
3vq1[4] I LP4
2-deoxy-3-O-[(3R)-3-hydroxytetradecanoyl]-2-{[(3R)..
A 0.0
/28.9
1
/2
TLR4_MOUSE Toll-like receptor 4
4g8a[2] L LP4
2-deoxy-3-O-[(3R)-3-hydroxytetradecanoyl]-2-{[(3R)..
A 0.0
/30.0
1
/1
TLR4_HUMAN Toll-like receptor 4
5ijd[1] O LP4
2-deoxy-3-O-[(3R)-3-hydroxytetradecanoyl]-2-{[(3R)..
A 0.0
/29.2
1
/1
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
7mlm[2] G ZKM
N-[(1S,2R,3E)-2-hydroxy-1-{[(3-O-sulfo-beta-D-gala..
A 0.0
/29.2
2
/3
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
7mlm[2] G ZKM
N-[(1S,2R,3E)-2-hydroxy-1-{[(3-O-sulfo-beta-D-gala..
A 0.0
/29.2
4
/4
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
7mlm[2] H ZKM
N-[(1S,2R,3E)-2-hydroxy-1-{[(3-O-sulfo-beta-D-gala..
A 0.0
/29.2
1
/2
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
7mlm[2] K ZKM
N-[(1S,2R,3E)-2-hydroxy-1-{[(3-O-sulfo-beta-D-gala..
A 0.0
/29.2
4
/4
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
3vq1[4] M LP5
(R)-((2R,3S,4R,5R,6R)-3-HYDROXY-2-(HYDROXYMETHYL)-..
A 0.0
/28.9
3
/3
TLR4_MOUSE Toll-like receptor 4
3vq2[1] K LP5
(R)-((2R,3S,4R,5R,6R)-3-HYDROXY-2-(HYDROXYMETHYL)-..
A 0.0
/29.6
1
/1
TLR4_MOUSE Toll-like receptor 4
4g8a[2] S LP5
(R)-((2R,3S,4R,5R,6R)-3-HYDROXY-2-(HYDROXYMETHYL)-..
A 0.0
/30.0
4
/4
TLR4_HUMAN Toll-like receptor 4
5ijd[2] U LP5
(R)-((2R,3S,4R,5R,6R)-3-HYDROXY-2-(HYDROXYMETHYL)-..
A 0.0
/29.2
4
/4
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
5ijc[2] N V2A
neoseptin 3[35 atoms]
A 0.0
/29.7
4
/4
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
5ijc[2] V V2A
neoseptin 3[35 atoms]
A 0.0
/29.7
2
/2
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
2z81[1] E PCJ
(2R)-3-{[(2S)-3-HYDROXY-2-(PALMITOYLAMINO)PROPYL]T..
A 50.0
/29.0
20
/21
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
2z82[1] E PDJ
(2R)-3-{[(2R)-2-AMINO-3-HYDROXYPROPYL]THIO}PROPANE..
A 44.4
/29.0
18
/19
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
3a79[1] O PXS
(2S)-propane-1,2-diyl dihexadecanoate[39 atoms]
A 42.9
/29.0
21
/24
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
3a7b[1] D LTC
(2S)-1-({3-O-[2-(acetylamino)-4-amino-2,4,6-trideo..
A 38.9
/29.0
18
/18
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
3a7c[1] E PDK
(10S,13R)-3-{2-[{2-[bis(carboxymethyl)amino]ethyl}..
A 35.7
/29.0
14
/15
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1041 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3fxi[2] X MG
MAGNESIUM ION[1 atoms]
A 100.0
/31.3
1
/1
TLR4_HUMAN Toll-like receptor 4
3rfs[1] C MG
MAGNESIUM ION[1 atoms]
A 0.0
/31.5
1
/1
D2P9A6_LISM2 Q4G1L3_EPTBU Internalin B, repeat modules, Variable lymphocyte ..
5wk4[1] H MG
MAGNESIUM ION[1 atoms]
B 0.0
/28.9
1
/1
Variable lymphocyte receptor 39
5wk4[2] I MG
MAGNESIUM ION[1 atoms]
E 0.0
/28.9
1
/1
Variable lymphocyte receptor 39
5y3j[2] Q MG
MAGNESIUM ION[1 atoms]
A 25.0
/37.7
4
/4
TLR9_HORSE Toll-like receptor 9
1gwb[1] C PT
PLATINUM (II) ION[1 atoms]
A 0.0
/35.6
2
/2
GPBA_HUMAN PLATELET GLYCOPROTEIN IB ALPHA CHAIN
1qyy[2] D PT
PLATINUM (II) ION[1 atoms]
A 0.0
/35.6
2
/2
GPBA_HUMAN Platelet glycoprotein Ib alpha chain
1qyy[1] E PT
PLATINUM (II) ION[1 atoms]
A 0.0
/35.6
2
/2
GPBA_HUMAN Platelet glycoprotein Ib alpha chain
4kng[2] H NI
NICKEL (II) ION[1 atoms]
A 0.0
/35.2
2
/2
LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled r..
5mx0[2] L NI
NICKEL (II) ION[1 atoms]
A 0.0
/35.1
1
/1
FMOD_HUMAN Fibromodulin
3zyo[1] B ZN
ZINC ION[1 atoms]
A 0.0
/30.4
3
/3
LRC4B_MOUSE LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4B
4u06[1] B ZN
ZINC ION[1 atoms]
A 50.0
/33.4
2
/2
Q72U33_LEPIC LIC10831
4u06[2] C ZN
ZINC ION[1 atoms]
A 66.7
/33.4
3
/3
Q72U33_LEPIC LIC10831
4u06[1] D ZN
ZINC ION[1 atoms]
A 33.3
/33.4
3
/3
Q72U33_LEPIC LIC10831
5z8y[2] P ZN
ZINC ION[1 atoms]
A 0.0
/33.0
2
/2
LRRT2_HUMAN Leucine-rich repeat transmembrane neuronal protein..
3p72[1] C CL
CHLORIDE ION[1 atoms]
A 50.0
/35.4
2
/2
GP1BA_HUMAN Platelet glycoprotein Ib alpha chain
4pq8[1] B CL
CHLORIDE ION[1 atoms]
A 33.3
/36.4
3
/3
DESIGNED PROTEIN OR465
4qxe[1] F CL
CHLORIDE ION[1 atoms]
A 0.0
/33.4
1
/1
LGR4_HUMAN Q4G1L2_EPTBU Leucine-rich repeat-containing G-protein coupled r..
4qxe[1] G CL
CHLORIDE ION[1 atoms]
A 0.0
/33.4
1
/2
LGR4_HUMAN Q4G1L2_EPTBU Leucine-rich repeat-containing G-protein coupled r..
4u06[1] F CL
CHLORIDE ION[1 atoms]
A 20.0
/33.4
5
/5
Q72U33_LEPIC LIC10831
4u06[1] G CL
CHLORIDE ION[1 atoms]
A 50.0
/33.4
4
/4
Q72U33_LEPIC LIC10831
4u06[1] H CL
CHLORIDE ION[1 atoms]
A 0.0
/33.4
1
/1
Q72U33_LEPIC LIC10831
4u7l[1] G CL
CHLORIDE ION[1 atoms]
A 0.0
/28.1
3
/3
LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domai..
4ufr[2] F CL
CHLORIDE ION[1 atoms]
A 50.0
/35.2
2
/2
LGR5_HUMAN LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED R..
4ufr[2] G CL
CHLORIDE ION[1 atoms]
A 0.0
/35.2
2
/2
LGR5_HUMAN LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED R..
4ufr[1] H CL
CHLORIDE ION[1 atoms]
A 0.0
/35.2
2
/3
LGR5_HUMAN LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED R..
5lfn[2] E CL
CHLORIDE ION[1 atoms]
B 0.0
/30.8
2
/2
CHAD_HUMAN Chondroadherin
5mx0[1] M CL
CHLORIDE ION[1 atoms]
B 0.0
/35.1
2
/2
FMOD_HUMAN Fibromodulin
5uei[1] B CL
CHLORIDE ION[1 atoms]
A 0.0
/35.1
5
/5
O13
5xnp[2] FA CL
CHLORIDE ION[1 atoms]
A 100.0
/33.2
1
/1
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnp[2] O CL
CHLORIDE ION[1 atoms]
A 0.0
/33.2
2
/2
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnp[2] P CL
CHLORIDE ION[1 atoms]
A 0.0
/33.2
1
/2
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnp[2] Q CL
CHLORIDE ION[1 atoms]
A 100.0
/33.2
2
/2
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnq[2] J CL
CHLORIDE ION[1 atoms]
A 0.0
/32.1
1
/1
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnq[2] K CL
CHLORIDE ION[1 atoms]
A 0.0
/32.1
1
/1
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
3wpc[1] U NA
SODIUM ION[1 atoms]
B 0.0
/37.6
2
/2
Q2EEY0_HORSE Toll-like receptor 9
5xnp[4] H NA
SODIUM ION[1 atoms]
A 66.7
/33.2
3
/3
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnp[2] W NA
SODIUM ION[1 atoms]
A 100.0
/33.2
1
/1
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnq[2] C NA
SODIUM ION[1 atoms]
A 25.0
/32.1
4
/6
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnq[2] E NA
SODIUM ION[1 atoms]
A 0.0
/32.1
2
/2
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5gmf[3] O CA
CALCIUM ION[1 atoms]
A 0.0
/43.1
1
/1
B3Y653_MACMU Toll-like receptor 7
5xnp[4] I CA
CALCIUM ION[1 atoms]
A 50.0
/33.2
2
/2
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnp[2] J CA
CALCIUM ION[1 atoms]
A 0.0
/33.2
2
/2
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnp[2] K CA
CALCIUM ION[1 atoms]
A 0.0
/33.2
2
/2
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnp[2] M CA
CALCIUM ION[1 atoms]
A 50.0
/33.2
2
/2
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnp[4] X CA
CALCIUM ION[1 atoms]
A 0.0
/33.2
2
/2
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnq[2] H CA
CALCIUM ION[1 atoms]
A 0.0
/32.1
2
/2
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xnq[2] I CA
CALCIUM ION[1 atoms]
A 0.0
/32.1
2
/2
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
3t6q[1] J CU
COPPER (II) ION[1 atoms]
A 0.0
/30.0
2
/2
CD180_MOUSE CD180 antigen
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
1041 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2id5[2] I alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. B 28.6
/31.9
7
/7
Q96FE5_HUMAN Leucine rich repeat neuronal 6A
5gij[1] G alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. A 62.5
/33.6
8
/8
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
5z14[1] F alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. B 100.0
/100.0
14
/14
TLR8_HUMAN Toll-like receptor 8
3ulu[2] L alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. A 42.9
/31.1
7
/7
TLR3_HUMAN Toll-like receptor 3
4r07[6] K alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. C 100.0
/100.0
13
/13
TLR8_HUMAN Toll-like receptor 8
5az5[5] M alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. C 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
5hdh[1] B alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. A 100.0
/100.0
13
/13
TLR8_HUMAN Toll-like receptor 8
6gff[1] U alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. J 42.9
/32.5
7
/7
LRC32_HUMAN Leucine-rich repeat-containing protein 32
3w3j[16] C alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/100.0
14
/14
TLR8_HUMAN Toll-like receptor 8
5az5[2] G alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
7crf[2] G alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 100.0
/100.0
8
/8
TLR8_HUMAN Toll-like receptor 8
3w3k[20] C alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/100.0
13
/13
TLR8_HUMAN Toll-like receptor 8
3w3k[20] E alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/100.0
9
/9
TLR8_HUMAN Toll-like receptor 8
5hdh[12] D alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/100.0
8
/8
TLR8_HUMAN Toll-like receptor 8
6ty5[11] C alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/100.0
14
/14
TLR8_HUMAN Toll-like receptor 8
7drc[2] I alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 50.0
/31.3
10
/11
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
3wn4[4] B alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/100.0
14
/14
TLR8_HUMAN Toll-like receptor 8
4qbz[1] C alpha-D-mannopyranose-(2-3)-[beta-D-mannopyranose-.. A 100.0
/100.0
14
/14
TLR8_HUMAN Toll-like receptor 8
6v9u[1] H alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. B 100.0
/100.0
11
/11
TLR8_HUMAN Toll-like receptor 8
6zjz[1] C alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 100.0
/100.0
15
/15
TLR8_HUMAN Toll-like receptor 8
6zjz[1] E alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
7crf[1] C alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 100.0
/100.0
14
/14
TLR8_HUMAN Toll-like receptor 8
7crf[1] F alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. B 100.0
/100.0
14
/14
TLR8_HUMAN Toll-like receptor 8
7ytx[2] E alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 100.0
/100.0
11
/11
TLR8_HUMAN Toll-like receptor 8
7crf[1] H alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
7ytx[1] C alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 100.0
/100.0
14
/14
TLR8_HUMAN Toll-like receptor 8
2a0z[7] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/30.7
2
/2
TLR3_HUMAN Toll-like receptor 3
2z64[1] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 16.7
/28.8
6
/6
TLR4_MOUSE Toll-like receptor 4
2z64[1] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/28.8
3
/3
TLR4_MOUSE Toll-like receptor 4
2z65[7] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/31.0
3
/3
TLR4_HUMAN Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
2z66[4] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 57.1
/30.0
7
/7
Q4G1L2_EPTBU TLR4_HUMAN Variable lymphocyte receptor B, Toll-like receptor..
2z81[1] B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 66.7
/29.0
3
/3
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
3rg1[7] Q beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/31.2
6
/6
A6QNK7_BOVIN CD180 molecule
3ulu[1] M beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 25.0
/31.1
4
/4
TLR3_HUMAN Toll-like receptor 3
3w3g[20] C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
13
/13
TLR8_HUMAN Toll-like receptor 8
3w3g[23] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
12
/12
TLR8_HUMAN Toll-like receptor 8
3w3g[37] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
11
/11
TLR8_HUMAN Toll-like receptor 8
3w3n[3] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
1
/1
TLR8_HUMAN Toll-like receptor 8
4bsr[1] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/35.2
2
/2
LGR5_HUMAN LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED R..
4lxr[2] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 22.2
/29.3
9
/9
TOLL_DROME Protein toll
4oqt[7] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 28.6
/31.9
7
/7
LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain..
4oqt[2] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/31.9
2
/4
LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain..
5zln[1] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 25.0
/35.9
8
/9
TLR9_MOUSE Toll-like receptor 9
5zln[1] H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/35.9
3
/3
TLR9_MOUSE Toll-like receptor 9
6gff[3] O beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. I 16.7
/34.3
6
/6
LRC32_HUMAN Leucine-rich repeat-containing protein 32
6lvz[4] C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 37.5
/43.2
8
/8
B3Y653_MACMU Toll-like receptor 7
6s6q[1] H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 0.0
/31.5
1
/1
GSO1_ARATH LRR receptor-like serine/threonine-protein kinase ..
6s6q[1] J beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 60.0
/31.5
5
/5
GSO1_ARATH LRR receptor-like serine/threonine-protein kinase ..
6ty5[12] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
7c76[9] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/30.7
3
/3
TLR3_HUMAN Toll-like receptor 3
7c77[1] C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 40.0
/36.4
5
/5
TLR3_MOUSE Toll-like receptor 3
7drb[2] H beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 50.0
/29.4
4
/4
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7drb[1] N beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. D 50.0
/29.4
2
/2
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7drb[2] R beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. D 33.3
/29.4
3
/5
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7drc[1] K beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 66.7
/31.3
3
/3
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7drc[2] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 45.5
/31.3
11
/11
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7wm4[4] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 50.0
/35.7
2
/4
TLR3_MOUSE Toll-like receptor 3
7wrq[1] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 40.0
/31.9
5
/5
ALS_HUMAN Insulin-like growth factor-binding protein complex..
1xec[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/32.3
4
/4
PGS2_BOVIN Decorin
1ziw[16] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/31.3
6
/6
TLR3_HUMAN Toll-like receptor 3
1ziw[6] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/31.3
3
/4
TLR3_HUMAN Toll-like receptor 3
1ziw[3] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/31.3
6
/6
TLR3_HUMAN Toll-like receptor 3
1ziw[25] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/31.3
4
/4
TLR3_HUMAN Toll-like receptor 3
2a0z[1] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/30.7
1
/2
TLR3_HUMAN Toll-like receptor 3
2a0z[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 20.0
/30.7
5
/5
TLR3_HUMAN Toll-like receptor 3
2a0z[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/30.7
4
/4
TLR3_HUMAN Toll-like receptor 3
2a0z[3] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/30.7
4
/4
TLR3_HUMAN Toll-like receptor 3
2id5[3] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/31.9
1
/3
Q96FE5_HUMAN Leucine rich repeat neuronal 6A
2z62[11] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/31.0
4
/4
TLR4_HUMAN Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
2z63[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/31.5
2
/2
TLR4_HUMAN Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
2z66[4] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 16.7
/30.0
6
/6
Q4G1L2_EPTBU TLR4_HUMAN Variable lymphocyte receptor B, Toll-like receptor..
3a79[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/29.0
9
/9
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
3b2d[2] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/29.9
5
/6
CD180_HUMAN CD180 antigen
3cig[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/36.3
3
/4
TLR3_MOUSE Toll-like receptor 3
3fxi[2] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 42.9
/31.3
7
/7
TLR4_HUMAN Toll-like receptor 4
3o6n[1] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/33.3
4
/5
APL1
3oja[2] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/33.3
2
/3
Anopheles Plasmodium-responsive Leucine-rich repea..
3t6q[2] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 14.3
/30.0
7
/7
CD180_MOUSE CD180 antigen
3t6q[31] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 25.0
/30.0
4
/4
CD180_MOUSE CD180 antigen
3ulu[2] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/31.1
4
/4
TLR3_HUMAN Toll-like receptor 3
3ulu[2] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/31.1
4
/4
TLR3_HUMAN Toll-like receptor 3
3ulu[2] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/31.1
2
/2
TLR3_HUMAN Toll-like receptor 3
3ulv[1] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/30.7
4
/4
TLR3_HUMAN Toll-like receptor 3
3w3g[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
13
/13
TLR8_HUMAN Toll-like receptor 8
3w3j[43] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
10
/10
TLR8_HUMAN Toll-like receptor 8
3w3j[12] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
1
/1
TLR8_HUMAN Toll-like receptor 8
3wpb[10] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/37.3
6
/6
Q2EEY0_HORSE Toll-like receptor 9
4kt1[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/34.2
3
/3
LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled r..
4lxs[5] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/29.5
4
/4
TOLL_DROME Protein toll
4p8s[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/31.5
3
/5
R4RL2_RAT Reticulon-4 receptor-like 2
4r09[4] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
9
/9
TLR8_HUMAN Toll-like receptor 8
4z0c[2] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/31.5
5
/7
TLR13_MOUSE Toll-like receptor 13
4z0c[2] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/31.5
6
/6
TLR13_MOUSE Toll-like receptor 13
4z0c[1] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/31.5
4
/4
TLR13_MOUSE Toll-like receptor 13
5d3i[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 42.9
/29.7
7
/7
TLR2_MOUSE Toll-like receptor 2
5gij[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/33.6
1
/1
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
5gij[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/33.6
2
/2
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
5gij[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/33.6
2
/2
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
5gij[1] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 20.0
/33.6
5
/6
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
5gmf[43] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 37.5
/43.1
8
/8
B3Y653_MACMU Toll-like receptor 7
5hdh[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
7
/7
TLR8_HUMAN Toll-like receptor 8
5hyx[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/32.4
4
/5
Y4265_ARATH Probable LRR receptor-like serine/threonine-protei..
5ijb[1] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 50.0
/29.1
2
/2
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
5ijc[3] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/29.7
4
/4
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
5ijc[2] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/29.7
7
/7
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
5ijc[1] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 50.0
/29.1
2
/2
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
5zln[2] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/35.9
5
/5
TLR9_MOUSE Toll-like receptor 9
5zln[2] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/35.9
3
/3
TLR9_MOUSE Toll-like receptor 9
5zln[2] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/35.9
3
/3
TLR9_MOUSE Toll-like receptor 9
5zln[2] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/35.9
6
/6
TLR9_MOUSE Toll-like receptor 9
5zln[3] O 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/35.9
1
/1
TLR9_MOUSE Toll-like receptor 9
5zln[1] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/35.8
3
/3
TLR9_MOUSE Toll-like receptor 9
6s6q[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/31.5
2
/2
GSO1_ARATH LRR receptor-like serine/threonine-protein kinase ..
6s6q[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 50.0
/31.5
4
/4
GSO1_ARATH LRR receptor-like serine/threonine-protein kinase ..
6s6q[1] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 66.7
/31.5
3
/3
GSO1_ARATH LRR receptor-like serine/threonine-protein kinase ..
7b1b[1] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 0.0
/30.7
1
/5
A0A6I8TEX2_AEDAE Toll-like receptor
7c76[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/30.7
6
/6
TLR3_HUMAN Toll-like receptor 3
7c77[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/36.4
1
/3
TLR3_MOUSE Toll-like receptor 3
7c77[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/36.4
2
/2
TLR3_MOUSE Toll-like receptor 3
7drb[1] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 50.0
/29.4
2
/2
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7drb[2] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 33.3
/29.4
3
/4
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7wm4[2] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/35.7
4
/6
TLR3_MOUSE Toll-like receptor 3
7wm4[6] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/35.7
2
/2
TLR3_MOUSE Toll-like receptor 3
7wv3[4] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/30.7
4
/4
TLR3_HUMAN Toll-like receptor 3
7wv5[2] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/31.1
4
/4
TLR3_HUMAN Toll-like receptor 3
7ytp[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 37.5
/44.2
8
/8
B3Y653_MACMU Toll-like receptor 7
7ytp[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 85.7
/44.2
7
/8
B3Y653_MACMU Toll-like receptor 7
7ytp[2] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 16.7
/44.2
6
/6
B3Y653_MACMU Toll-like receptor 7
3e6j[1] B alpha-L-fucopyranose-(1-2)-beta-D-galactopyranose-.. A 8.3
/30.2
12
/13
Variable lymphocyte receptor diversity region
5uf1[2] C alpha-L-fucopyranose-(1-2)-beta-D-galactopyranose-.. A 9.1
/35.1
11
/14
O13
5ufc[3] D alpha-L-fucopyranose-(1-2)-beta-D-galactopyranose-.. A 12.5
/36.6
16
/17
Tn4-22
3cig[1] F beta-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-.. A 25.0
/36.3
4
/5
TLR3_MOUSE Toll-like receptor 3
3cig[1] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-alp.. A 0.0
/36.3
1
/3
TLR3_MOUSE Toll-like receptor 3
2id5[2] E alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 28.6
/31.9
7
/7
Q96FE5_HUMAN Leucine rich repeat neuronal 6A
2id5[3] F alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 0.0
/31.9
3
/8
Q96FE5_HUMAN Leucine rich repeat neuronal 6A
2id5[5] H alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 25.0
/31.9
4
/4
Q96FE5_HUMAN Leucine rich repeat neuronal 6A
2z81[2] C alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 28.6
/29.0
7
/7
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
3a7c[1] C alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 42.9
/29.0
7
/7
TLR2_MOUSE Q4G1L2_EPTBU Toll-like receptor 2, Variable lymphocyte receptor..
3ciy[1] I alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 33.3
/35.7
3
/5
TLR3_MOUSE Toll-like receptor 3
1p9a[1] B beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1.. A 0.0
/35.6
2
/2
GPBA_HUMAN Platelet glycoprotein Ib alpha chain precursor
1qyy[1] C alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. A 25.0
/35.6
4
/4
GPBA_HUMAN Platelet glycoprotein Ib alpha chain
5mx0[2] C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/35.1
3
/4
FMOD_HUMAN Fibromodulin
5mx0[2] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 50.0
/35.1
2
/2
FMOD_HUMAN Fibromodulin
5mx0[2] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 50.0
/35.1
4
/4
FMOD_HUMAN Fibromodulin
5mx0[2] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/35.1
1
/7
FMOD_HUMAN Fibromodulin
5uf4[3] D beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-b.. A 9.1
/35.1
11
/17
O13
2z63[1] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be.. A 0.0
/31.5
3
/3
TLR4_HUMAN Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
3cig[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be.. A 100.0
/36.3
2
/4
TLR3_MOUSE Toll-like receptor 3
3ciy[1] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be.. D 33.3
/35.1
3
/4
TLR3_MOUSE Toll-like receptor 3
3ciy[2] J beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-alp.. C 0.0
/35.7
1
/2
TLR3_MOUSE Toll-like receptor 3
3ciy[1] P alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. D 33.3
/35.1
3
/5
TLR3_MOUSE Toll-like receptor 3
7la8[2] C 3-O-sulfo-beta-D-galactopyranose-(1-4)-2-acetamido.. A 33.3
/35.1
6
/12
O6 variable lymphocyte receptor
5gij[1] H alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. A 0.0
/33.6
2
/2
TDR_ARATH Leucine-rich repeat receptor-like protein kinase T..
3oja[1] F alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. B 0.0
/33.3
3
/6
Anopheles Plasmodium-responsive Leucine-rich repea..
4bv4[1] D alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. C 0.0
/32.0
6
/7
TOLL_DROME Q4G1L2_EPTBU PROTEIN TOLL, VARIABLE LYMPHOCYTE RECEPTOR B CHIME..
3j0a[2] E alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 0.0
/31.2
3
/5
TLR5_HUMAN Toll-like receptor 5
3j0a[2] F alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 40.0
/31.2
5
/5
TLR5_HUMAN Toll-like receptor 5
3j0a[2] G alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 100.0
/31.2
1
/1
TLR5_HUMAN Toll-like receptor 5
3j0a[2] H alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 42.9
/31.2
7
/7
TLR5_HUMAN Toll-like receptor 5
3j0a[2] I alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 66.7
/31.2
3
/3
TLR5_HUMAN Toll-like receptor 5
5zsn[1] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 33.3
/43.2
9
/9
B3Y653_MACMU Toll-like receptor 7
6s6q[1] I beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 66.7
/31.5
3
/3
GSO1_ARATH LRR receptor-like serine/threonine-protein kinase ..
2a0z[1] K 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. A 0.0
/30.7
2
/2
TLR3_HUMAN Toll-like receptor 3
3cig[3] B 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. A 40.0
/36.3
5
/5
TLR3_MOUSE Toll-like receptor 3
3cig[1] E 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. A 0.0
/36.3
2
/2
TLR3_MOUSE Toll-like receptor 3
4p8s[1] B 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. A 0.0
/31.5
2
/2
R4RL2_RAT Reticulon-4 receptor-like 2
3fxi[1] E L-glycero-alpha-D-manno-heptopyranose-(1-7)-L-glyc.. A 33.3
/31.3
3
/4
TLR4_HUMAN Toll-like receptor 4
3fxi[1] H L-glycero-alpha-D-manno-heptopyranose-(1-7)-L-glyc.. B 33.3
/31.3
3
/4
TLR4_HUMAN Toll-like receptor 4
7wv5[2] H beta-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1.. A 37.5
/31.1
8
/8
TLR3_HUMAN Toll-like receptor 3
2a0z[1] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 33.3
/30.7
3
/3
TLR3_HUMAN Toll-like receptor 3
2a0z[1] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. A 25.0
/30.7
4
/4
TLR3_HUMAN Toll-like receptor 3
2a0z[1] I alpha-D-mannopyranose-(1-3)-[beta-D-mannopyranose-.. A 50.0
/30.7
6
/6
TLR3_HUMAN Toll-like receptor 3
5uff[1] B alpha-L-fucopyranose-(1-2)-beta-D-galactopyranose-.. A 9.1
/30.2
11
/12
RBC36
3b2d[1] E alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 44.4
/29.9
9
/9
CD180_HUMAN CD180 antigen
3t6q[1] E alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 44.4
/30.0
9
/9
CD180_MOUSE CD180 antigen
3b2d[1] G alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. B 44.4
/29.9
9
/9
CD180_HUMAN CD180 antigen
3rg1[8] R alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 44.4
/31.2
9
/9
A6QNK7_BOVIN CD180 molecule
2z62[1] B beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/31.0
5
/5
TLR4_HUMAN Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
2z64[1] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 33.3
/28.8
3
/3
TLR4_MOUSE Toll-like receptor 4
2z66[4] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/30.0
1
/1
Q4G1L2_EPTBU TLR4_HUMAN Variable lymphocyte receptor B, Toll-like receptor..
4lxr[2] D alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/29.3
6
/7
TOLL_DROME Protein toll
7drb[2] E alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. B 14.3
/29.4
7
/15
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7drb[2] I alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. B 55.6
/29.4
9
/11
A0A2I8B6R1_NICBE Membrane-localized LRR receptor-like protein
7mlm[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 33.3
/29.2
3
/4
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1041 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3w3g[69] B TLR8_HUMAN Toll-like receptor 8[743 aa] A 100.0
/100.0
26
/26
TLR8_HUMAN Toll-like receptor 8
3wn4[2] A TLR8_HUMAN Toll-like receptor 8[747 aa] A 100.0
/100.0
24
/24
TLR8_HUMAN Toll-like receptor 8
6zjz[10] B TLR8_HUMAN Toll-like receptor 8[740 aa] A 100.0
/100.0
32
/32
TLR8_HUMAN Toll-like receptor 8
6wml[1] C TLR8_HUMAN Toll-like receptor 8[681 aa] D 100.0
/100.0
43
/43
TLR8_HUMAN Toll-like receptor 8
5gmf[50] C B3Y653_MACMU Toll-like receptor 7[776 aa] A 51.2
/43.1
43
/47
B3Y653_MACMU Toll-like receptor 7
7cyn[1] B TLR7_HUMAN Toll-like receptor 7[786 aa] A 100.0
/43.2
1
/1
TLR7_HUMAN Toll-like receptor 7
7cyn[1] A TLR7_HUMAN Toll-like receptor 7[786 aa] B 100.0
/43.2
1
/1
TLR7_HUMAN Toll-like receptor 7
7ytp[2] B B3Y653_MACMU Toll-like receptor 7[731 aa] A 65.4
/44.2
26
/26
B3Y653_MACMU Toll-like receptor 7
8ttz[2] B G8E2R2_MACMU Toll-like receptor 7[772 aa] A 15.8
/43.2
19
/24
G8E2R2_MACMU Toll-like receptor 7
1fyw[4] A TLR2_HUMAN TOLL-LIKE RECEPTOR 2[149 aa] A 26.7
/43.0
15
/16
TLR2_HUMAN TOLL-LIKE RECEPTOR 2
1o77[4] B TLR2_HUMAN TOLL-LIKE RECEPTOR 2[135 aa] A 23.1
/41.4
13
/14
TLR2_HUMAN TOLL-LIKE RECEPTOR 2
1o77[4] C TLR2_HUMAN TOLL-LIKE RECEPTOR 2[135 aa] A 20.0
/41.4
5
/6
TLR2_HUMAN TOLL-LIKE RECEPTOR 2
2j67[1] A TLR10_HUMAN TOLL LIKE RECEPTOR 10[141 aa] B 28.6
/40.6
14
/14
TLR10_HUMAN TOLL LIKE RECEPTOR 10
2j67[1] B TLR10_HUMAN TOLL LIKE RECEPTOR 10[134 aa] A 23.1
/38.2
13
/13
TLR10_HUMAN TOLL LIKE RECEPTOR 10
6tl8[4] D CD33_HUMAN LRFN4_MOUSE Myeloid cell surface antigen CD33,Leucine-rich rep.. A 58.3
/38.3
12
/18
CD33_HUMAN LRFN4_MOUSE Myeloid cell surface antigen CD33,Leucine-rich rep..
3wpe[4] A TLR9_BOVIN Toll-like receptor 9[714 aa] A 30.6
/37.4
36
/36
TLR9_BOVIN Toll-like receptor 9
3wpc[2] B Q2EEY0_HORSE Toll-like receptor 9[749 aa] A 26.2
/37.4
42
/42
Q2EEY0_HORSE Toll-like receptor 9
4om7[2] B TLR6_HUMAN Toll-like receptor 6[143 aa] A 30.0
/36.6
10
/12
TLR6_HUMAN Toll-like receptor 6
5zln[2] B TLR9_MOUSE Toll-like receptor 9[753 aa] A 28.2
/35.9
39
/39
TLR9_MOUSE Toll-like receptor 9
4bsr[12] B LGR5_HUMAN LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED R.. A 0.0
/35.2
3
/15
LGR5_HUMAN LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED R..
4kng[2] B LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled r.. A 33.3
/35.2
6
/6
LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled r..
4ufr[2] C LGR5_HUMAN LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED R.. A 0.0
/35.2
3
/10
LGR5_HUMAN LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED R..
6f2o[2] A LRFN5_MOUSE Leucine-rich repeat and fibronectin type-III domai.. A 35.7
/34.3
14
/21
LRFN5_MOUSE Leucine-rich repeat and fibronectin type-III domai..
4li1[2] B LGR4_XENTR Leucine-rich repeat-containing G-protein coupled r.. A 0.0
/33.4
2
/6
LGR4_XENTR Leucine-rich repeat-containing G-protein coupled r..
4li1[2] B LGR4_XENTR Leucine-rich repeat-containing G-protein coupled r.. A 17.6
/33.4
17
/28
LGR4_XENTR Leucine-rich repeat-containing G-protein coupled r..
2ft3[6] B PGS1_BOVIN Biglycan[303 aa] A 20.0
/32.9
25
/32
PGS1_BOVIN Biglycan
7ylf[4] A E5L3Q3_CHICK Toll-like receptor 15[143 aa] A 20.8
/33.1
24
/24
E5L3Q3_CHICK Toll-like receptor 15
5xnp[2] B LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai.. A 50.0
/33.2
16
/28
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xwt[2] D LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai.. B 66.7
/32.6
12
/24
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
1xcd[6] A PGS2_BOVIN Decorin[305 aa] A 13.6
/32.3
22
/25
PGS2_BOVIN Decorin
5xnq[2] A LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai.. A 46.2
/32.1
13
/25
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
5xws[2] A LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai.. A 50.0
/32.1
12
/25
LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domai..
3j0a[1] B TLR5_HUMAN Toll-like receptor 5[632 aa] A 25.0
/31.2
8
/8
TLR5_HUMAN Toll-like receptor 5
3j0a[1] A TLR5_HUMAN Toll-like receptor 5[797 aa] B 0.0
/32.0
4
/8
TLR5_HUMAN Toll-like receptor 5
2id5[4] B Q96FE5_HUMAN Leucine rich repeat neuronal 6A[473 aa] A 10.5
/31.9
19
/19
Q96FE5_HUMAN Leucine rich repeat neuronal 6A
4oqt[2] A LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain.. A 10.0
/31.9
10
/19
LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain..
5xwu[2] D LRFN1_MOUSE Leucine-rich repeat and fibronectin type III domai.. B 31.2
/31.9
16
/27
LRFN1_MOUSE Leucine-rich repeat and fibronectin type III domai..
4z0c[2] B TLR13_MOUSE Toll-like receptor 13[709 aa] A 25.0
/31.5
16
/18
TLR13_MOUSE Toll-like receptor 13
7wv3[16] B TLR3_HUMAN Toll-like receptor 3[668 aa] A 12.5
/30.7
8
/9
TLR3_HUMAN Toll-like receptor 3
7wv3[2] A TLR3_HUMAN Toll-like receptor 3[668 aa] D 0.0
/30.7
1
/1
TLR3_HUMAN Toll-like receptor 3
3rg1[6] E A6QNK7_BOVIN CD180 molecule[599 aa] A 0.0
/31.2
2
/2
A6QNK7_BOVIN CD180 molecule
3rg1[1] C A6QNK7_BOVIN CD180 molecule[397 aa] G 0.0
/31.0
4
/4
A6QNK7_BOVIN CD180 molecule
8h6f[1] E Repebody (A6)[260 aa] D 0.0
/31.0
1
/1
Repebody (A6)
8h6f[1] F Repebody (A6)[260 aa] D 50.0
/31.0
2
/3
Repebody (A6)
8h6f[1] D Repebody (A6)[260 aa] E 0.0
/31.0
1
/1
Repebody (A6)
8h6f[1] D Repebody (A6)[260 aa] F 33.3
/31.0
3
/3
Repebody (A6)
5lfn[4] B CHAD_HUMAN Chondroadherin[324 aa] A 16.7
/30.8
6
/13
CHAD_HUMAN Chondroadherin
3t6q[2] C CD180_MOUSE CD180 antigen[601 aa] A 16.7
/30.0
6
/6
CD180_MOUSE CD180 antigen
3fxi[2] B TLR4_HUMAN Toll-like receptor 4[601 aa] A 23.1
/31.3
13
/14
TLR4_HUMAN Toll-like receptor 4
4g8a[2] B TLR4_HUMAN Toll-like receptor 4[605 aa] A 16.7
/30.0
12
/13
TLR4_HUMAN Toll-like receptor 4
3b2d[2] B CD180_HUMAN CD180 antigen[601 aa] A 28.6
/29.9
7
/8
CD180_HUMAN CD180 antigen
3vq1[4] C TLR4_MOUSE Toll-like receptor 4[596 aa] A 9.1
/28.9
11
/11
TLR4_MOUSE Toll-like receptor 4
7b1b[1] A A0A6I8TEX2_AEDAE Toll-like receptor[754 aa] D 0.0
/30.7
1
/3
A0A6I8TEX2_AEDAE Toll-like receptor
7b1c[4] E A0A6I8TEX2_AEDAE Toll-like receptor[751 aa] A 0.0
/30.7
8
/21
A0A6I8TEX2_AEDAE Toll-like receptor
5ijd[2] D TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor.. A 0.0
/29.2
7
/7
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4, Variable lymphocyte receptor..
7mlm[2] A TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor .. A 17.6
/29.2
17
/19
TLR4_MOUSE Q4G1L2_EPTBU Toll-like receptor 4,Variable lymphocyte receptor ..
2wfh[2] B SLIT2_HUMAN SLIT HOMOLOG 2 PROTEIN C-PRODUCT[181 aa] A 28.6
/28.4
28
/29
SLIT2_HUMAN SLIT HOMOLOG 2 PROTEIN C-PRODUCT
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1041 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3w3g[1] O BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
A 100.0
/100.0
6
/6
TLR8_HUMAN Toll-like receptor 8
6zjz[1] T FMT
FORMIC ACID[3 atoms]
B 100.0
/100.0
5
/5
TLR8_HUMAN Toll-like receptor 8
1gwb[27] K SO4
SULFATE ION[5 atoms]
B 0.0
/35.6
3
/3
GPBA_HUMAN PLATELET GLYCOPROTEIN IB ALPHA CHAIN
1ziw[1] J SO4
SULFATE ION[5 atoms]
A 25.0
/31.3
4
/4
TLR3_HUMAN Toll-like receptor 3
1ziw[1] K SO4
SULFATE ION[5 atoms]
A 25.0
/31.3
4
/4
TLR3_HUMAN Toll-like receptor 3