Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1700140 479 8 Q9H074(PAIP1_HUMAN) RecName: Full=Polyadenylate-binding protein-interacting protein 1 ; Short=PABP-interacting protein 1; Short=PAIP-1; Short=Poly(A)-binding protein-interacting protein 1;
QUERYSEQ 
MSDGFDRAPGAGRGRSRGLGRGGGGPEGGGFPNGAGPAERARHQPPQPKAPGFLQPPPLRQPRTTPPPGAQCEVPASPQRPSRPGALPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLSVNAPEFYPSGYSSSYTESYED
GCEDYPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQVTRADILQVGL
RELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLKLVELRSSNWGRVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY
LDDIDDEMDPEIEEAYEKFCLESERKRKQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q9H074(PAIP1_HUMAN)]

479
region name description
1-479 CHAIN /note="Polyadenylate-binding protein-interacting protein 1" /id="PRO_0000058177"
159-376 DOMAIN /note="MIF4G"
1-114 REGION /note="Disordered"
116-143 REGION /note="PABPC1-interacting motif-2 (PAM2)"
157-375 REGION /note="PAIP1 middle domain (PAIP1M)"
435-455 REGION /note="Disordered"
440-479 REGION /note="PABPC1-interacting motif-1 (PAM1)"
49-74 COMPBIAS /note="Pro residues"
94-114 COMPBIAS /note="Polar residues"
1-479 DISORDER predicted by DISOPRED

MONOMER
479
pdb_id a1 identity[%]2 description
6yxj B 100.0 PAIP1_HUMAN Polyadenylate-binding protein-interacting protein 1
1jh4 B 100.0 PAIP1_HUMAN polyadenylate-binding protein-interacting protein-1 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
479 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1jh4[1] A PABP1_HUMAN polyadenylate-binding protein 1[98 aa] B 100.0
/100.0		 17
/17		 PAIP1_HUMAN polyadenylate-binding protein-interacting protein-..
6yxj[1] A R1A_SARS Non-structural protein 3[128 aa] B 100.0
/100.0		 12
/12		 PAIP1_HUMAN Polyadenylate-binding protein-interacting protein ..
6zmw[1] DB IF4A1_HUMAN Eukaryotic initiation factor 4A-I[384 aa] EB 32.1
/30.7		 28
/28		 IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1..
8huj[1] A IF4A1_HUMAN Eukaryotic initiation factor 4A-I[383 aa] B 23.8
/32.0		 21
/23		 IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
479 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8huj[1] C IRES RNA (J-K-St) B 8.3
/32.0		 24
/27		 IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1..
8j7r[1] B IRES RNA (J-K-St) A 9.5
/32.0		 21
/24		 IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.