HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

1695111

1473

247

Q9C000(NLRP1_HUMAN)

RecName: Full=NACHT, LRR and PYD domains-containing protein 1 ; EC=3.4.-.- ; EC=3.6.4.- ;AltName: Full=Caspase recruitment domain-containing protein 7;AltName: Full=Death effector filament-forming ced-4-like apoptosis protein ;AltName: Full=Nucleotide-binding domain and caspase recruitment domain;Contains: RecName: Full=NACHT, LRR and PYD domains-containing protein 1, C-terminus ; Short=NLRP1-CT ;Contains: RecName: Full=NACHT, LRR and PYD domains-containing protein 1, N-terminus ; Short=NLRP1-NT ;

QUERYSEQ

MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQYGEQRAWDLALHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPWIHELPAGCTQGSERRVLRQLPDTSGRRWRE
ISASLLYQALPSSPDHESPSQESPNAPTSTAVLGSWGSPPQPSLAPREQEAPGTQWPLDETSGIYYTEIREREREKSEKGRPPWAAVVGTPPQAHTSLQPHHHPWEPSVRESLCSTWPWKNEDFNQKFTQLLLLQRPHPRSQDPLVKRSW
PDYVEENRGHLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQEPSSELCLHWSQPQPADALLGSLLGKTILP
EASFLITARTTALQNLIPSLEQARWVEVLGFSESSRKEYFYRYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKRKEKLTLTSKTTTTLCLHYLAQALQAQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAI
ISTFLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYVLEDEKGRGKHSNCIIDLEKTLEAYGIHGLFGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNLMQWVPSLQLLLQPHSLESLHCLYETRNKTFLTQVMAHFEEMGMCVETDME
LLVCTFCIKFSRHVKKLQLIEGRQHRSTWSPTMVVLFRWVPVTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQ
LVSCGLTSDCCQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQTTLSDEMRQELRALEQEKPQLLIFSRRKPSVMTPTEGLDTGEMSNSTSSLKRQRLGSERAASHVAQANLKLLDVSKIFPIAEIAEESSPE
VVPVELLCVPSPASQGDLHTKPLGTDDDFWGPTGPVATEVVDKEKNLYRVHFPVAGSYRWPNTGLCFVMREAVTVEIEFCVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARV
ELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIRKAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGEDQLFSEFYVGHLGSGIRLQVKDKKDETLVWEALV
KPGDLMPATTLIPPARIAVPSPLDAPQLLHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEKGSKKGLLPLSS

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q9C000(NLRP1_HUMAN)]

1473
	region	name	description
	1-1473	CHAIN	/note="NACHT, LRR and PYD domains-containing protein 1" /id="PRO_0000096710"
	1-1212	CHAIN	/note="NACHT, LRR and PYD domains-containing protein 1, N- terminus" /id="PRO_0000452851"
	1213-1473	CHAIN	/note="NACHT, LRR and PYD domains-containing protein 1, C- terminus" /id="PRO_0000452852"
	1-92	DOMAIN	/note="Pyrin"
	328-637	DOMAIN	/note="NACHT"
	809-830	REPEAT	/note="LRR 1"
	838-858	REPEAT	/note="LRR 2"
	866-887	REPEAT	/note="LRR 3"
	895-915	REPEAT	/note="LRR 4"
	923-944	REPEAT	/note="LRR 5"
	950-973	REPEAT	/note="LRR 6"
	1079-1364	DOMAIN	/note="FIIND"
	1374-1463	DOMAIN	/note="CARD"
	90-113	REGION	/note="Disordered"
	160-254	REGION	/note="Disordered"
	991-1017	REGION	/note="Disordered"
	1079-1212	REGION	/note="ZU5"
	1213-1364	REGION	/note="UPA"
	160-187	COMPBIAS	/note="Polar residues"
	215-231	COMPBIAS	/note="Basic and acidic residues"
	997-1015	COMPBIAS	/note="Polar residues"
	334-341	BINDING	/ligand="ATP" /ligand_id="ChEBI:CHEBI:30616"
	1-1473	DISORDER	predicted by DISOPRED

MONOMER

1473

pdb_id a¹ identity[%]² description

7wge A 100.0 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N-terminus

7pzc H 41.8 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7crw B 68.3 D9I2G3_RAT NLR family protein 1

1pn5 A 100.0 SPG1_STRSG NAL1_HUMAN NACHT-, LRR- and PYD-containing protein 2

6xkk A 100.0 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

4ifp A 89.0 MALE_ECOLI NLRP1_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and PYD domains-containing protein 1

4per A 30.8 Q5ZIY8_CHICK Ribonuclease Inhibitor

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

1473 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6x6a[2] C NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[13.. B 100.0
/100.0 36
/36 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6x6a[2] B NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[13.. C 100.0
/100.0 25
/25 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

7wge[1] B A0A2H1VFV3_SPOFR Thioredoxin[106 aa] A 100.0
/100.0 14
/14 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..

7crv[2] B D9I2G3_RAT NLR family protein 1[146 aa] A 50.0
/70.7 6
/6 D9I2G3_RAT NLR family protein 1

7crv[2] D D9I2G3_RAT NLR family protein 1[142 aa] A 75.6
/70.7 41
/41 D9I2G3_RAT NLR family protein 1

7crv[2] A D9I2G3_RAT NLR family protein 1[140 aa] B 88.9
/66.7 9
/9 D9I2G3_RAT NLR family protein 1

7crv[2] C D9I2G3_RAT NLR family protein 1[143 aa] B 67.9
/66.7 28
/28 D9I2G3_RAT NLR family protein 1

7crw[2] A M0R781_RAT Dipeptidyl peptidase 9[837 aa] B 52.6
/68.3 19
/19 D9I2G3_RAT NLR family protein 1

7crw[1] D M0R781_RAT Dipeptidyl peptidase 9[807 aa] C 33.3
/65.7 3
/3 D9I2G3_RAT NLR family protein 1

7keu[4] D CASP1_HUMAN Caspase-1[85 aa] E 36.4
/55.0 11
/11 ASC_HUMAN Apoptosis-associated speck-like protein containing..

7keu[3] D CASP1_HUMAN Caspase-1[85 aa] F 37.5
/55.0 8
/8 ASC_HUMAN Apoptosis-associated speck-like protein containing..

7keu[1] D CASP1_HUMAN Caspase-1[85 aa] H 75.0
/55.0 4
/4 ASC_HUMAN Apoptosis-associated speck-like protein containing..

5h8o[1] A VHH nanobody[107 aa] B 33.3
/53.5 3
/3 ASC_HUMAN Apoptosis-associated speck-like protein containing..

6x6a[3] A DPP9_HUMAN Dipeptidyl peptidase 9[846 aa] B 100.0
/100.0 15
/15 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6x6a[2] A DPP9_HUMAN Dipeptidyl peptidase 9[846 aa] C 100.0
/100.0 2
/2 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6x6a[2] A DPP9_HUMAN Dipeptidyl peptidase 9[846 aa] D 100.0
/100.0 25
/25 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6x6a[2] E DPP9_HUMAN Dipeptidyl peptidase 9[846 aa] D 100.0
/100.0 1
/1 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6x6c[1] A DPP9_HUMAN Dipeptidyl peptidase 9[846 aa] D 100.0
/100.0 1
/1 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

7jkq[2] A DPP9_HUMAN Dipeptidyl peptidase 9[827 aa] B 50.0
/51.1 14
/15 CARD8_HUMAN Caspase recruitment domain-containing protein 8

7jkq[2] A DPP9_HUMAN Dipeptidyl peptidase 9[827 aa] C 40.0
/49.6 5
/5 CARD8_HUMAN Caspase recruitment domain-containing protein 8

8ej4[10] K NEK7_HUMAN Serine/threonine-protein kinase Nek7[261 aa] A 0.0
/44.9 4
/13 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

3tsr[4] A RNAS1_MOUSE Ribonuclease pancreatic[124 aa] E 14.3
/44.4 7
/23 RINI_MOUSE Ribonuclease inhibitor

1dfj[1] A RNAS1_BOVIN RIBONUCLEASE A[124 aa] B 28.6
/40.3 7
/28 RINI_PIG RIBONUCLEASE INHIBITOR

4peq[2] A RNAS1_BOVIN Ribonuclease pancreatic[124 aa] B 40.0
/44.3 5
/28 Q3SZN8_BOVIN Ribonuclease/angiogenin inhibitor 1

6npy[1] B E2AK2_HUMAN NEK7_HUMAN Protein kinase R,Serine/threonine-protein kinase N.. A 34.8
/44.1 23
/29 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

1a4y[2] B ANGI_HUMAN ANGIOGENIN[123 aa] A 0.0
/37.4 7
/33 RINI_HUMAN RIBONUCLEASE INHIBITOR

1z7x[4] A RNAS1_HUMAN Ribonuclease I[126 aa] B 0.0
/37.4 2
/32 RINI_HUMAN Ribonuclease inhibitor

2bex[2] C RNKD_HUMAN NONSECRETORY RIBONUCLEASE[135 aa] A 8.3
/37.4 12
/43 RINI_HUMAN RIBONUCLEASE INHIBITOR

4per[1] B ANGI_CHICK Angiogenin[109 aa] A 20.0
/30.8 20
/28 Q5ZIY8_CHICK Ribonuclease Inhibitor

6b5b[1] A BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e[1199 .. B 50.0
/29.0 2
/31 NLRC4_MOUSE NLR family CARD domain-containing protein 4

5yud[1] B FLJB_SALTY FLIC_SALTY Phase 2 flagellin,Flagellin[75 aa] A 0.0
/27.5 2
/55 Q8CGT2_MOUSE Baculoviral IAP repeat-containing protein 1e

6b5b[1] B NLRC4_MOUSE NLR family CARD domain-containing protein 4[903 aa.. A 21.4
/27.5 14
/25 BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e

6b5b[1] D G8UUW9_LEGPN Flagellin[68 aa] A 25.0
/27.5 4
/24 BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

1473 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7wge[1] C AGS
PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom.. A 100.0
/100.0 17
/17 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..

8ej4[10] U AGS
PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom.. A 76.9
/44.9 13
/19 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

5irl[4] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 78.6
/32.5 14
/17 G1T469_RABIT Uncharacterized protein

6npy[11] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 66.7
/44.1 9
/12 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7alv[1] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 78.6
/44.3 14
/18 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtp[6] G ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 76.9
/45.2 13
/16 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtq[12] M ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 71.4
/44.0 14
/18 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

7wbt[2] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 69.2
/36.9 13
/19 NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9

7wbu[2] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 80.0
/36.9 10
/15 NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9

7zgu[6] G ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 81.8
/45.0 11
/15 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8etr[1] D WTN
(6S,8R)-N-[(1,2,3,5,6,7-hexahydro-s-indacen-4-yl)c.. A 57.1
/44.3 14
/14 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7alv[1] B RM5
1-[4-chloranyl-2,6-di(propan-2-yl)phenyl]-3-[4-(2-.. A 44.4
/44.3 18
/18 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtp[6] H 7YN
1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-.. A 61.5
/45.2 13
/13 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtq[12] N 7YN
1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-.. A 66.7
/44.0 12
/12 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

7pzc[10] L 8GI
1-(1,2,3,5,6,7-hexahydro-s-indacen-4-yl)-3-[4-(2-o.. A 60.0
/41.8 15
/15 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

5yud[1] C ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] A 62.5
/27.5 8
/10 Q8CGT2_MOUSE Baculoviral IAP repeat-containing protein 1e

7rav[1] B ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] A 53.3
/27.5 15
/17 BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

1473 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5y3s[1] F NA
SODIUM ION[1 atoms] A 100.0
/100.0 7
/7 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

7wge[1] D MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 2
/2 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..

8ej4[11] V MG
MAGNESIUM ION[1 atoms] A 66.7
/44.9 3
/3 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

4ewi[4] C CL
CHLORIDE ION[1 atoms] A 50.0
/32.5 2
/2 NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

1473 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3kat[2] A NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84.. A 85.7
/100.0 7
/7 NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6k7v[11] B NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84.. A 100.0
/100.0 3
/3 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6k7v[9] G NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84.. A 100.0
/100.0 3
/3 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6k7v[8] H NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84.. A 100.0
/100.0 6
/6 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6k7v[11] I NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84.. A 100.0
/100.0 2
/2 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6k7v[9] J NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84.. A 100.0
/100.0 3
/3 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6k7v[8] K NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84.. A 100.0
/100.0 7
/7 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6xkk[21] B NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85.. A 100.0
/100.0 2
/2 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6xkk[19] C NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85.. A 100.0
/100.0 5
/5 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6xkk[18] H NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85.. A 100.0
/100.0 8
/8 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6xkk[44] W NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85.. A 100.0
/100.0 4
/4 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6xkk[21] A NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85.. B 100.0
/100.0 2
/2 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6xkk[19] A NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85.. C 100.0
/100.0 6
/6 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6xkk[18] D NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85.. E 100.0
/100.0 10
/10 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

4im6[2] A NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[19.. A 100.0
/100.0 15
/15 NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6x6a[2] D NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[14.. C 100.0
/100.0 15
/15 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6x6a[2] C NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[13.. D 100.0
/100.0 12
/12 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6x6c[1] D NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[13.. C 100.0
/100.0 38
/38 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

6x6c[1] C NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[13.. D 100.0
/100.0 26
/26 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

7crv[2] D D9I2G3_RAT NLR family protein 1[142 aa] B 80.0
/66.7 15
/15 D9I2G3_RAT NLR family protein 1

7crw[1] C D9I2G3_RAT NLR family protein 1[134 aa] B 76.5
/68.3 17
/17 D9I2G3_RAT NLR family protein 1

7crw[1] B D9I2G3_RAT NLR family protein 1[279 aa] C 75.0
/65.7 16
/16 D9I2G3_RAT NLR family protein 1

6k99[71] B ASC_HUMAN Apoptosis-associated speck-like protein containing.. A 66.7
/56.8 3
/3 ASC_HUMAN Apoptosis-associated speck-like protein containing..

6k99[20] F ASC_HUMAN Apoptosis-associated speck-like protein containing.. A 50.0
/56.8 4
/4 ASC_HUMAN Apoptosis-associated speck-like protein containing..

6k99[51] H ASC_HUMAN Apoptosis-associated speck-like protein containing.. A 0.0
/56.8 2
/2 ASC_HUMAN Apoptosis-associated speck-like protein containing..

7keu[1] H ASC_HUMAN Apoptosis-associated speck-like protein containing.. E 50.0
/55.0 6
/6 ASC_HUMAN Apoptosis-associated speck-like protein containing..

7keu[1] E ASC_HUMAN Apoptosis-associated speck-like protein containing.. H 80.0
/55.0 5
/5 ASC_HUMAN Apoptosis-associated speck-like protein containing..

7jkq[2] C CARD8_HUMAN Caspase recruitment domain-containing protein 8[12.. B 64.3
/51.1 14
/14 CARD8_HUMAN Caspase recruitment domain-containing protein 8

7jkq[2] B CARD8_HUMAN Caspase recruitment domain-containing protein 8[27.. C 41.2
/49.6 17
/17 CARD8_HUMAN Caspase recruitment domain-containing protein 8

7vtp[6] C NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79.. A 0.0
/45.2 3
/7 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtp[6] E NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79.. A 22.2
/45.2 9
/9 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7zgu[6] C NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80.. A 0.0
/45.0 3
/8 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7zgu[6] E NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80.. A 33.3
/45.0 9
/9 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8ej4[10] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[85.. A 26.7
/44.9 15
/17 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8ej4[10] J NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[85.. A 50.0
/44.9 6
/18 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7lfh[12] B NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[80.. A 0.0
/43.8 6
/6 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

7lfh[12] L NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[80.. A 14.3
/43.8 7
/20 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

7vtq[12] G NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[78.. A 11.1
/44.0 9
/9 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

7vtq[12] H NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[78.. A 0.0
/44.0 6
/17 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

7pzc[10] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88.. A 50.0
/41.8 4
/13 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzc[10] D NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88.. A 28.6
/41.8 7
/7 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzc[2] H NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[10.. A 16.7
/41.8 6
/6 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

4xhs[2] B MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and.. A 20.0
/38.9 5
/11 MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..

1a4y[6] C RINI_HUMAN RIBONUCLEASE INHIBITOR[460 aa] A 42.9
/37.4 7
/33 RINI_HUMAN RIBONUCLEASE INHIBITOR

4n1j[16] B NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[9.. A 46.7
/37.2 15
/16 NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14

4n1j[1] B NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[9.. D 60.0
/37.2 5
/5 NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14

4n1k[4] C NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[8.. A 66.7
/37.2 3
/10 NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14

7wbt[2] B NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9[89.. A 21.7
/36.9 23
/31 NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9

5irm[1] B G1T469_RABIT Uncharacterized protein[770 aa] A 26.3
/32.8 19
/23 G1T469_RABIT Uncharacterized protein

4ewi[2] A NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[91.. A 0.0
/32.5 4
/10 NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4

4ewi[4] B NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[90.. A 42.9
/32.5 14
/23 NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4

4ewi[2] B NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[90.. A 25.0
/32.5 4
/5 NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4

4q62[2] A Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro.. A 63.6
/32.4 11
/33 Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..

6b5b[1] B NLRC4_MOUSE NLR family CARD domain-containing protein 4[903 aa.. C 0.0
/29.0 1
/26 NLRC4_MOUSE NLR family CARD domain-containing protein 4

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

1473 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5y3s[1] E PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

5y3s[1] G PO4
PHOSPHATE ION[5 atoms] C 100.0
/100.0 1
/1 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

4ifp[3] G MLI
MALONATE ION[7 atoms] A 100.0
/89.0 5
/5 MALE_ECOLI NLRP1_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..

4ewi[2] E SO4
SULFATE ION[5 atoms] B 0.0
/32.5 3
/3 NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4

4q62[2] B SO4
SULFATE ION[5 atoms] A 50.0
/32.4 4
/4 Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..

4q62[2] C SO4
SULFATE ION[5 atoms] A 33.3
/32.4 3
/3 Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..

4r5d[1] F SO4
SULFATE ION[5 atoms] A 0.0
/37.7 1
/5 Leucine rich repeat protein

5h7n[1] F SO4
SULFATE ION[5 atoms] A 33.3
/38.2 3
/3 NLRP12-PYD with MBP tag

5h7n[1] K SO4
SULFATE ION[5 atoms] B 50.0
/37.2 2
/3 NLRP12-PYD with MBP tag

6ki0[2] E SO4
SULFATE ION[5 atoms] A 100.0
/56.8 2
/3 MALE_ECOLI ASC_HUMAN Maltose/maltodextrin-binding periplasmic protein,A..

6ki0[1] F SO4
SULFATE ION[5 atoms] A 100.0
/56.8 4
/4 MALE_ECOLI ASC_HUMAN Maltose/maltodextrin-binding periplasmic protein,A..

3tsr[1] J PEG
DI(HYDROXYETHYL)ETHER[7 atoms] E 33.3
/44.4 3
/3 RINI_MOUSE Ribonuclease inhibitor

4xhs[1] F FMT
FORMIC ACID[3 atoms] A 25.0
/38.9 4
/4 MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..

2bex[1] E GOL
GLYCEROL[6 atoms] A 20.0
/37.4 5
/5 RINI_HUMAN RIBONUCLEASE INHIBITOR

4im6[2] B GOL
GLYCEROL[6 atoms] A 100.0
/100.0 4
/4 NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

4im6[2] B GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

4n1j[5] E GOL
GLYCEROL[6 atoms] A 50.0
/37.2 4
/4 NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14

3tsr[3] K EDO
1,2-ETHANEDIOL[4 atoms] E 20.0
/44.4 5
/5 RINI_MOUSE Ribonuclease inhibitor

4q62[2] J EDO
1,2-ETHANEDIOL[4 atoms] A 0.0
/32.4 3
/3 Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..

4q62[2] K EDO
1,2-ETHANEDIOL[4 atoms] A 0.0
/32.4 2
/2 Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..

4q62[2] L EDO
1,2-ETHANEDIOL[4 atoms] A 0.0
/32.4 2
/2 Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..

4q62[4] N EDO
1,2-ETHANEDIOL[4 atoms] A 0.0
/32.4 4
/4 Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..

4q62[2] P EDO
1,2-ETHANEDIOL[4 atoms] A 0.0
/32.4 2
/2 Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..

4q62[2] Q EDO
1,2-ETHANEDIOL[4 atoms] A 0.0
/32.4 2
/3 Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..

4r5d[1] G EDO
1,2-ETHANEDIOL[4 atoms] A 0.0
/37.7 2
/2 Leucine rich repeat protein

5h7n[2] I EDO
1,2-ETHANEDIOL[4 atoms] A 40.0
/38.2 5
/5 NLRP12-PYD with MBP tag

5h7n[1] Q EDO
1,2-ETHANEDIOL[4 atoms] B 0.0
/37.2 2
/2 NLRP12-PYD with MBP tag

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
1473
	pdb_id	a¹	identity[%]²	description
	7wge	A	100.0	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N-terminus
	7pzc	H	41.8	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7crw	B	68.3	D9I2G3_RAT NLR family protein 1
	1pn5	A	100.0	SPG1_STRSG NAL1_HUMAN NACHT-, LRR- and PYD-containing protein 2
	6xkk	A	100.0	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	4ifp	A	89.0	MALE_ECOLI NLRP1_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and PYD domains-containing protein 1
	4per	A	30.8	Q5ZIY8_CHICK Ribonuclease Inhibitor
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
1473	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6x6a[2]	C	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[13..	B	100.0 /100.0	36 /36	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6x6a[2]	B	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[13..	C	100.0 /100.0	25 /25	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	7wge[1]	B	A0A2H1VFV3_SPOFR Thioredoxin[106 aa]	A	100.0 /100.0	14 /14	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..
	7crv[2]	B	D9I2G3_RAT NLR family protein 1[146 aa]	A	50.0 /70.7	6 /6	D9I2G3_RAT NLR family protein 1
	7crv[2]	D	D9I2G3_RAT NLR family protein 1[142 aa]	A	75.6 /70.7	41 /41	D9I2G3_RAT NLR family protein 1
	7crv[2]	A	D9I2G3_RAT NLR family protein 1[140 aa]	B	88.9 /66.7	9 /9	D9I2G3_RAT NLR family protein 1
	7crv[2]	C	D9I2G3_RAT NLR family protein 1[143 aa]	B	67.9 /66.7	28 /28	D9I2G3_RAT NLR family protein 1
	7crw[2]	A	M0R781_RAT Dipeptidyl peptidase 9[837 aa]	B	52.6 /68.3	19 /19	D9I2G3_RAT NLR family protein 1
	7crw[1]	D	M0R781_RAT Dipeptidyl peptidase 9[807 aa]	C	33.3 /65.7	3 /3	D9I2G3_RAT NLR family protein 1
	7keu[4]	D	CASP1_HUMAN Caspase-1[85 aa]	E	36.4 /55.0	11 /11	ASC_HUMAN Apoptosis-associated speck-like protein containing..
	7keu[3]	D	CASP1_HUMAN Caspase-1[85 aa]	F	37.5 /55.0	8 /8	ASC_HUMAN Apoptosis-associated speck-like protein containing..
	7keu[1]	D	CASP1_HUMAN Caspase-1[85 aa]	H	75.0 /55.0	4 /4	ASC_HUMAN Apoptosis-associated speck-like protein containing..
	5h8o[1]	A	VHH nanobody[107 aa]	B	33.3 /53.5	3 /3	ASC_HUMAN Apoptosis-associated speck-like protein containing..
	6x6a[3]	A	DPP9_HUMAN Dipeptidyl peptidase 9[846 aa]	B	100.0 /100.0	15 /15	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6x6a[2]	A	DPP9_HUMAN Dipeptidyl peptidase 9[846 aa]	C	100.0 /100.0	2 /2	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6x6a[2]	A	DPP9_HUMAN Dipeptidyl peptidase 9[846 aa]	D	100.0 /100.0	25 /25	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6x6a[2]	E	DPP9_HUMAN Dipeptidyl peptidase 9[846 aa]	D	100.0 /100.0	1 /1	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6x6c[1]	A	DPP9_HUMAN Dipeptidyl peptidase 9[846 aa]	D	100.0 /100.0	1 /1	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	7jkq[2]	A	DPP9_HUMAN Dipeptidyl peptidase 9[827 aa]	B	50.0 /51.1	14 /15	CARD8_HUMAN Caspase recruitment domain-containing protein 8
	7jkq[2]	A	DPP9_HUMAN Dipeptidyl peptidase 9[827 aa]	C	40.0 /49.6	5 /5	CARD8_HUMAN Caspase recruitment domain-containing protein 8
	8ej4[10]	K	NEK7_HUMAN Serine/threonine-protein kinase Nek7[261 aa]	A	0.0 /44.9	4 /13	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	3tsr[4]	A	RNAS1_MOUSE Ribonuclease pancreatic[124 aa]	E	14.3 /44.4	7 /23	RINI_MOUSE Ribonuclease inhibitor
	1dfj[1]	A	RNAS1_BOVIN RIBONUCLEASE A[124 aa]	B	28.6 /40.3	7 /28	RINI_PIG RIBONUCLEASE INHIBITOR
	4peq[2]	A	RNAS1_BOVIN Ribonuclease pancreatic[124 aa]	B	40.0 /44.3	5 /28	Q3SZN8_BOVIN Ribonuclease/angiogenin inhibitor 1
	6npy[1]	B	E2AK2_HUMAN NEK7_HUMAN Protein kinase R,Serine/threonine-protein kinase N..	A	34.8 /44.1	23 /29	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	1a4y[2]	B	ANGI_HUMAN ANGIOGENIN[123 aa]	A	0.0 /37.4	7 /33	RINI_HUMAN RIBONUCLEASE INHIBITOR
	1z7x[4]	A	RNAS1_HUMAN Ribonuclease I[126 aa]	B	0.0 /37.4	2 /32	RINI_HUMAN Ribonuclease inhibitor
	2bex[2]	C	RNKD_HUMAN NONSECRETORY RIBONUCLEASE[135 aa]	A	8.3 /37.4	12 /43	RINI_HUMAN RIBONUCLEASE INHIBITOR
	4per[1]	B	ANGI_CHICK Angiogenin[109 aa]	A	20.0 /30.8	20 /28	Q5ZIY8_CHICK Ribonuclease Inhibitor
	6b5b[1]	A	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e[1199 ..	B	50.0 /29.0	2 /31	NLRC4_MOUSE NLR family CARD domain-containing protein 4
	5yud[1]	B	FLJB_SALTY FLIC_SALTY Phase 2 flagellin,Flagellin[75 aa]	A	0.0 /27.5	2 /55	Q8CGT2_MOUSE Baculoviral IAP repeat-containing protein 1e
	6b5b[1]	B	NLRC4_MOUSE NLR family CARD domain-containing protein 4[903 aa..	A	21.4 /27.5	14 /25	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e
	6b5b[1]	D	G8UUW9_LEGPN Flagellin[68 aa]	A	25.0 /27.5	4 /24	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1473	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7wge[1]	C	AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom..	A	100.0 /100.0	17 /17	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..
	8ej4[10]	U	AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom..	A	76.9 /44.9	13 /19	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	5irl[4]	B	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	78.6 /32.5	14 /17	G1T469_RABIT Uncharacterized protein
	6npy[11]	C	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	66.7 /44.1	9 /12	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7alv[1]	C	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	78.6 /44.3	14 /18	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtp[6]	G	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	76.9 /45.2	13 /16	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtq[12]	M	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	71.4 /44.0	14 /18	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	7wbt[2]	C	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	69.2 /36.9	13 /19	NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9
	7wbu[2]	B	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	80.0 /36.9	10 /15	NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9
	7zgu[6]	G	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	81.8 /45.0	11 /15	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8etr[1]	D	WTN (6S,8R)-N-[(1,2,3,5,6,7-hexahydro-s-indacen-4-yl)c..	A	57.1 /44.3	14 /14	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7alv[1]	B	RM5 1-[4-chloranyl-2,6-di(propan-2-yl)phenyl]-3-[4-(2-..	A	44.4 /44.3	18 /18	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtp[6]	H	7YN 1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-..	A	61.5 /45.2	13 /13	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtq[12]	N	7YN 1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-..	A	66.7 /44.0	12 /12	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	7pzc[10]	L	8GI 1-(1,2,3,5,6,7-hexahydro-s-indacen-4-yl)-3-[4-(2-o..	A	60.0 /41.8	15 /15	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	5yud[1]	C	ATP ADENOSINE-5'-TRIPHOSPHATE[31 atoms]	A	62.5 /27.5	8 /10	Q8CGT2_MOUSE Baculoviral IAP repeat-containing protein 1e
	7rav[1]	B	ATP ADENOSINE-5'-TRIPHOSPHATE[31 atoms]	A	53.3 /27.5	15 /17	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1473	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5y3s[1]	F	NA SODIUM ION[1 atoms]	A	100.0 /100.0	7 /7	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	7wge[1]	D	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	2 /2	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..
	8ej4[11]	V	MG MAGNESIUM ION[1 atoms]	A	66.7 /44.9	3 /3	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	4ewi[4]	C	CL CHLORIDE ION[1 atoms]	A	50.0 /32.5	2 /2	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1473	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3kat[2]	A	NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84..	A	85.7 /100.0	7 /7	NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6k7v[11]	B	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84..	A	100.0 /100.0	3 /3	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6k7v[9]	G	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84..	A	100.0 /100.0	3 /3	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6k7v[8]	H	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84..	A	100.0 /100.0	6 /6	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6k7v[11]	I	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84..	A	100.0 /100.0	2 /2	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6k7v[9]	J	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84..	A	100.0 /100.0	3 /3	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6k7v[8]	K	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[84..	A	100.0 /100.0	7 /7	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6xkk[21]	B	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85..	A	100.0 /100.0	2 /2	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6xkk[19]	C	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85..	A	100.0 /100.0	5 /5	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6xkk[18]	H	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85..	A	100.0 /100.0	8 /8	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6xkk[44]	W	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85..	A	100.0 /100.0	4 /4	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6xkk[21]	A	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85..	B	100.0 /100.0	2 /2	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6xkk[19]	A	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85..	C	100.0 /100.0	6 /6	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6xkk[18]	D	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[85..	E	100.0 /100.0	10 /10	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	4im6[2]	A	NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[19..	A	100.0 /100.0	15 /15	NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6x6a[2]	D	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[14..	C	100.0 /100.0	15 /15	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6x6a[2]	C	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[13..	D	100.0 /100.0	12 /12	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6x6c[1]	D	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[13..	C	100.0 /100.0	38 /38	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	6x6c[1]	C	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[13..	D	100.0 /100.0	26 /26	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	7crv[2]	D	D9I2G3_RAT NLR family protein 1[142 aa]	B	80.0 /66.7	15 /15	D9I2G3_RAT NLR family protein 1
	7crw[1]	C	D9I2G3_RAT NLR family protein 1[134 aa]	B	76.5 /68.3	17 /17	D9I2G3_RAT NLR family protein 1
	7crw[1]	B	D9I2G3_RAT NLR family protein 1[279 aa]	C	75.0 /65.7	16 /16	D9I2G3_RAT NLR family protein 1
	6k99[71]	B	ASC_HUMAN Apoptosis-associated speck-like protein containing..	A	66.7 /56.8	3 /3	ASC_HUMAN Apoptosis-associated speck-like protein containing..
	6k99[20]	F	ASC_HUMAN Apoptosis-associated speck-like protein containing..	A	50.0 /56.8	4 /4	ASC_HUMAN Apoptosis-associated speck-like protein containing..
	6k99[51]	H	ASC_HUMAN Apoptosis-associated speck-like protein containing..	A	0.0 /56.8	2 /2	ASC_HUMAN Apoptosis-associated speck-like protein containing..
	7keu[1]	H	ASC_HUMAN Apoptosis-associated speck-like protein containing..	E	50.0 /55.0	6 /6	ASC_HUMAN Apoptosis-associated speck-like protein containing..
	7keu[1]	E	ASC_HUMAN Apoptosis-associated speck-like protein containing..	H	80.0 /55.0	5 /5	ASC_HUMAN Apoptosis-associated speck-like protein containing..
	7jkq[2]	C	CARD8_HUMAN Caspase recruitment domain-containing protein 8[12..	B	64.3 /51.1	14 /14	CARD8_HUMAN Caspase recruitment domain-containing protein 8
	7jkq[2]	B	CARD8_HUMAN Caspase recruitment domain-containing protein 8[27..	C	41.2 /49.6	17 /17	CARD8_HUMAN Caspase recruitment domain-containing protein 8
	7vtp[6]	C	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79..	A	0.0 /45.2	3 /7	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtp[6]	E	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79..	A	22.2 /45.2	9 /9	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7zgu[6]	C	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80..	A	0.0 /45.0	3 /8	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7zgu[6]	E	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80..	A	33.3 /45.0	9 /9	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8ej4[10]	B	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[85..	A	26.7 /44.9	15 /17	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8ej4[10]	J	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[85..	A	50.0 /44.9	6 /18	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7lfh[12]	B	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[80..	A	0.0 /43.8	6 /6	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	7lfh[12]	L	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[80..	A	14.3 /43.8	7 /20	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	7vtq[12]	G	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[78..	A	11.1 /44.0	9 /9	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	7vtq[12]	H	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[78..	A	0.0 /44.0	6 /17	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	7pzc[10]	B	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88..	A	50.0 /41.8	4 /13	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzc[10]	D	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88..	A	28.6 /41.8	7 /7	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzc[2]	H	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[10..	A	16.7 /41.8	6 /6	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	4xhs[2]	B	MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..	A	20.0 /38.9	5 /11	MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..
	1a4y[6]	C	RINI_HUMAN RIBONUCLEASE INHIBITOR[460 aa]	A	42.9 /37.4	7 /33	RINI_HUMAN RIBONUCLEASE INHIBITOR
	4n1j[16]	B	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[9..	A	46.7 /37.2	15 /16	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14
	4n1j[1]	B	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[9..	D	60.0 /37.2	5 /5	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14
	4n1k[4]	C	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[8..	A	66.7 /37.2	3 /10	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14
	7wbt[2]	B	NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9[89..	A	21.7 /36.9	23 /31	NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9
	5irm[1]	B	G1T469_RABIT Uncharacterized protein[770 aa]	A	26.3 /32.8	19 /23	G1T469_RABIT Uncharacterized protein
	4ewi[2]	A	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[91..	A	0.0 /32.5	4 /10	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4
	4ewi[4]	B	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[90..	A	42.9 /32.5	14 /23	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4
	4ewi[2]	B	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[90..	A	25.0 /32.5	4 /5	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4
	4q62[2]	A	Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..	A	63.6 /32.4	11 /33	Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..
	6b5b[1]	B	NLRC4_MOUSE NLR family CARD domain-containing protein 4[903 aa..	C	0.0 /29.0	1 /26	NLRC4_MOUSE NLR family CARD domain-containing protein 4
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1473	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5y3s[1]	E	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /100.0	2 /2	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	5y3s[1]	G	PO4 PHOSPHATE ION[5 atoms]	C	100.0 /100.0	1 /1	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	4ifp[3]	G	MLI MALONATE ION[7 atoms]	A	100.0 /89.0	5 /5	MALE_ECOLI NLRP1_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..
	4ewi[2]	E	SO4 SULFATE ION[5 atoms]	B	0.0 /32.5	3 /3	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4
	4q62[2]	B	SO4 SULFATE ION[5 atoms]	A	50.0 /32.4	4 /4	Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..
	4q62[2]	C	SO4 SULFATE ION[5 atoms]	A	33.3 /32.4	3 /3	Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..
	4r5d[1]	F	SO4 SULFATE ION[5 atoms]	A	0.0 /37.7	1 /5	Leucine rich repeat protein
	5h7n[1]	F	SO4 SULFATE ION[5 atoms]	A	33.3 /38.2	3 /3	NLRP12-PYD with MBP tag
	5h7n[1]	K	SO4 SULFATE ION[5 atoms]	B	50.0 /37.2	2 /3	NLRP12-PYD with MBP tag
	6ki0[2]	E	SO4 SULFATE ION[5 atoms]	A	100.0 /56.8	2 /3	MALE_ECOLI ASC_HUMAN Maltose/maltodextrin-binding periplasmic protein,A..
	6ki0[1]	F	SO4 SULFATE ION[5 atoms]	A	100.0 /56.8	4 /4	MALE_ECOLI ASC_HUMAN Maltose/maltodextrin-binding periplasmic protein,A..
	3tsr[1]	J	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	E	33.3 /44.4	3 /3	RINI_MOUSE Ribonuclease inhibitor
	4xhs[1]	F	FMT FORMIC ACID[3 atoms]	A	25.0 /38.9	4 /4	MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..
	2bex[1]	E	GOL GLYCEROL[6 atoms]	A	20.0 /37.4	5 /5	RINI_HUMAN RIBONUCLEASE INHIBITOR
	4im6[2]	B	GOL GLYCEROL[6 atoms]	A	100.0 /100.0	4 /4	NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	4im6[2]	B	GOL GLYCEROL[6 atoms]	A	100.0 /100.0	3 /3	NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	4n1j[5]	E	GOL GLYCEROL[6 atoms]	A	50.0 /37.2	4 /4	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14
	3tsr[3]	K	EDO 1,2-ETHANEDIOL[4 atoms]	E	20.0 /44.4	5 /5	RINI_MOUSE Ribonuclease inhibitor
	4q62[2]	J	EDO 1,2-ETHANEDIOL[4 atoms]	A	0.0 /32.4	3 /3	Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..
	4q62[2]	K	EDO 1,2-ETHANEDIOL[4 atoms]	A	0.0 /32.4	2 /2	Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..
	4q62[2]	L	EDO 1,2-ETHANEDIOL[4 atoms]	A	0.0 /32.4	2 /2	Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..
	4q62[4]	N	EDO 1,2-ETHANEDIOL[4 atoms]	A	0.0 /32.4	4 /4	Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..
	4q62[2]	P	EDO 1,2-ETHANEDIOL[4 atoms]	A	0.0 /32.4	2 /2	Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..
	4q62[2]	Q	EDO 1,2-ETHANEDIOL[4 atoms]	A	0.0 /32.4	2 /3	Q5ZUB7_LEGPH Leucine-rich repeat-and coiled coil-containing pro..
	4r5d[1]	G	EDO 1,2-ETHANEDIOL[4 atoms]	A	0.0 /37.7	2 /2	Leucine rich repeat protein
	5h7n[2]	I	EDO 1,2-ETHANEDIOL[4 atoms]	A	40.0 /38.2	5 /5	NLRP12-PYD with MBP tag
	5h7n[1]	Q	EDO 1,2-ETHANEDIOL[4 atoms]	B	0.0 /37.2	2 /2	NLRP12-PYD with MBP tag
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [Q9C000(NLRP1_HUMAN)]