Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1680448 296 61 Q99836(MYD88_HUMAN) RecName: Full=Myeloid differentiation primary response protein MyD88 ;
QUERYSEQ 
MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL
DDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q99836(MYD88_HUMAN)]

296
region name description
1-296 CHAIN /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666"
54-109 DOMAIN /note="Death"
159-293 DOMAIN /note="TIR"
110-155 REGION /note="Intermediate domain"
1-16 DISORDER predicted by DISOPRED

MONOMER
296
pdb_id a1 identity[%]2 description
2js7 A 100.0 MYD88_HUMAN Myeloid differentiation primary response protein MyD88
6i3n L 100.0 H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
296 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3mop[4] G IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. C 100.0
/100.0		 9
/9		 MYD88_HUMAN Myeloid differentiation primary response protein M..
3mop[3] G IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. D 100.0
/100.0		 6
/6		 MYD88_HUMAN Myeloid differentiation primary response protein M..
3mop[1] G IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. F 100.0
/100.0		 7
/7		 MYD88_HUMAN Myeloid differentiation primary response protein M..
4w8h[1] B hexa-His tag[4 aa] A 50.0
/33.1		 4
/5		 A6M946_HYDVU Toll-receptor-related 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
296 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4eo7[1] B MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 MYD88_HUMAN Myeloid differentiation primary response protein M..
4w8h[1] C CL
CHLORIDE ION[1 atoms] 		A 50.0
/33.1		 2
/2		 A6M946_HYDVU Toll-receptor-related 2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
296 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3mop[5] B MYD88_HUMAN Myeloid differentiation primary response protein M.. A 100.0
/100.0		 5
/5		 MYD88_HUMAN Myeloid differentiation primary response protein M..
3mop[63] D MYD88_HUMAN Myeloid differentiation primary response protein M.. A 100.0
/100.0		 12
/12		 MYD88_HUMAN Myeloid differentiation primary response protein M..
3mop[2] E MYD88_HUMAN Myeloid differentiation primary response protein M.. A 100.0
/100.0		 11
/11		 MYD88_HUMAN Myeloid differentiation primary response protein M..
3mop[3] A MYD88_HUMAN Myeloid differentiation primary response protein M.. D 100.0
/100.0		 10
/10		 MYD88_HUMAN Myeloid differentiation primary response protein M..
6i3n[9] B H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. A 100.0
/100.0		 9
/9		 H0Y4G9_HUMAN Myeloid differentiation primary response protein M..
4om7[2] B TLR6_HUMAN Toll-like receptor 6[143 aa] A 25.0
/30.8		 8
/12		 TLR6_HUMAN Toll-like receptor 6
1fyw[4] A TLR2_HUMAN TOLL-LIKE RECEPTOR 2[149 aa] A 26.7
/31.0		 15
/16		 TLR2_HUMAN TOLL-LIKE RECEPTOR 2
1o77[4] B TLR2_HUMAN TOLL-LIKE RECEPTOR 2[135 aa] A 8.3
/29.1		 12
/14		 TLR2_HUMAN TOLL-LIKE RECEPTOR 2
1o77[4] C TLR2_HUMAN TOLL-LIKE RECEPTOR 2[135 aa] A 40.0
/29.1		 5
/6		 TLR2_HUMAN TOLL-LIKE RECEPTOR 2
5uzb[19] B TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. A 50.0
/28.4		 6
/6		 TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap..
5uzb[8] H TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. A 0.0
/28.4		 2
/3		 TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap..
5uzb[8] J TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. A 25.0
/28.4		 4
/4		 TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap..
5uzb[8] M TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. A 30.0
/28.4		 10
/10		 TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap..
5uzb[11] N TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. A 0.0
/28.4		 8
/8		 TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.