Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
3970069 | 299 | 66 | Q99623(PHB2_HUMAN) | RecName: Full=Prohibitin-2;AltName: Full=B-cell receptor-associated protein BAP37;AltName: Full=D-prohibitin;AltName: Full=Repressor of estrogen receptor activity; |
QUERYSEQ |
MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNA SQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK |
299 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() |
2-299 | CHAIN | /note="Prohibitin-2" /id="PRO_0000213884" |
![]() ![]() ![]() |
19-49 | REGION | /note="Necessary for transcriptional repression" |
![]() ![]() ![]() |
121-124 | REGION | /note="LC3-interaction region" |
![]() ![]() ![]() |
150-174 | REGION | /note="Necessary for transcriptional repression" |
![]() ![]() ![]() |
190-238 | COILED | ECO:0007744|PDB:6IQE" |
![]() ![]() ![]() |
1-299 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
299 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | PHB2_HUMAN Prohibitin-2 | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
299 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | PHB1_HUMAN Prohibitin 1[272 aa] | B | 100.0 /100.0 |
14 /14 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() |
![]() |
E | PHB1_HUMAN Prohibitin 1[272 aa] | B | 100.0 /100.0 |
1 /1 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | PHB1_HUMAN Prohibitin 1[272 aa] | J | 100.0 /100.0 |
3 /3 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | PHB1_HUMAN Prohibitin 1[96 aa] | A | 100.0 /100.0 |
49 /49 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
X | PHB1_HUMAN Prohibitin 1[96 aa] | C | 100.0 /100.0 |
7 /7 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | PHB2_HUMAN Prohibitin-2[299 aa] | A | 43.8 /54.6 |
16 /16 |
PHB1_HUMAN Prohibitin 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | PHB2_HUMAN Prohibitin-2[299 aa] | A | 66.7 /54.6 |
3 /4 |
PHB1_HUMAN Prohibitin 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | PHB2_HUMAN Prohibitin-2[109 aa] | B | 45.8 /48.9 |
48 /48 |
PHB1_HUMAN Prohibitin 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | PHB2_HUMAN Prohibitin-2[109 aa] | B | 60.0 /48.9 |
5 /7 |
PHB1_HUMAN Prohibitin 1 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
299 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | PHB2_HUMAN Prohibitin-2[59 aa] | A | 100.0 /100.0 |
17 /17 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | PHB2_HUMAN Prohibitin-2[190 aa] | A | 100.0 /100.0 |
17 /17 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | PHB2_HUMAN Prohibitin-2[190 aa] | A | 100.0 /100.0 |
19 /19 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() |
![]() |
D | PHB2_HUMAN Prohibitin-2[299 aa] | B | 100.0 /100.0 |
1 /1 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() |
![]() |
F | PHB2_HUMAN Prohibitin-2[299 aa] | B | 100.0 /100.0 |
1 /1 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() |
![]() |
U | PHB2_HUMAN Prohibitin-2[299 aa] | A | 100.0 /100.0 |
1 /1 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() |
![]() |
W | PHB2_HUMAN Prohibitin-2[299 aa] | S | 100.0 /100.0 |
1 /1 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() |
![]() |
K | PHB2_HUMAN Prohibitin-2[299 aa] | G | 100.0 /100.0 |
1 /1 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | PHB2_HUMAN Prohibitin-2[109 aa] | A | 100.0 /100.0 |
26 /26 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | PHB2_HUMAN Prohibitin-2[109 aa] | A | 100.0 /100.0 |
3 /3 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | PHB2_HUMAN Prohibitin-2[109 aa] | C | 100.0 /100.0 |
17 /17 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() |
![]() |
A | PHB2_HUMAN Prohibitin-2[109 aa] | E | 100.0 /100.0 |
1 /1 |
PHB2_HUMAN Prohibitin-2 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | PHB1_HUMAN Prohibitin 1[272 aa] | A | 0.0 /54.6 |
1 /1 |
PHB1_HUMAN Prohibitin 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K | PHB1_HUMAN Prohibitin 1[272 aa] | A | 40.0 /54.6 |
15 /15 |
PHB1_HUMAN Prohibitin 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | PHB1_HUMAN Prohibitin 1[272 aa] | C | 0.0 /54.6 |
1 /1 |
PHB1_HUMAN Prohibitin 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | PHB1_HUMAN Prohibitin 1[272 aa] | K | 40.0 /54.6 |
20 /20 |
PHB1_HUMAN Prohibitin 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
V | PHB1_HUMAN Prohibitin 1[272 aa] | T | 100.0 /54.6 |
1 /1 |
PHB1_HUMAN Prohibitin 1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | PHB1_HUMAN Prohibitin 1[96 aa] | B | 50.0 /48.9 |
8 /13 |
PHB1_HUMAN Prohibitin 1 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | PHB1_HUMAN Prohibitin 1[96 aa] | T | 100.0 /54.6 |
1 /1 |
PHB1_HUMAN Prohibitin 1 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |