Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1685793 | 299 | 1 | Q99623(PHB2_HUMAN) | RecName: Full=Prohibitin-2;AltName: Full=B-cell receptor-associated protein BAP37;AltName: Full=D-prohibitin;AltName: Full=Repressor of estrogen receptor activity; |
QUERYSEQ |
MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNA SQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK |
299 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() |
2-299 | CHAIN | /note="Prohibitin-2" /id="PRO_0000213884" |
![]() ![]() ![]() |
19-49 | REGION | /note="Necessary for transcriptional repression" |
![]() ![]() ![]() |
121-124 | REGION | /note="LC3-interaction region" |
![]() ![]() ![]() |
150-174 | REGION | /note="Necessary for transcriptional repression" |
![]() ![]() ![]() |
190-238 | COILED | ECO:0007744|PDB:6IQE" |
![]() ![]() ![]() |
1-299 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
299 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | PHB2_HUMAN Prohibitin-2 | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
299 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | PHB2_HUMAN Prohibitin-2[59 aa] | A | 100.0 /100.0 |
17 /17 |
PHB2_HUMAN Prohibitin-2 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |