Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3970069 299 66 Q99623(PHB2_HUMAN) RecName: Full=Prohibitin-2;AltName: Full=B-cell receptor-associated protein BAP37;AltName: Full=D-prohibitin;AltName: Full=Repressor of estrogen receptor activity;
QUERYSEQ 
MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNA
SQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q99623(PHB2_HUMAN)]

299
region name description
2-299 CHAIN /note="Prohibitin-2" /id="PRO_0000213884"
19-49 REGION /note="Necessary for transcriptional repression"
121-124 REGION /note="LC3-interaction region"
150-174 REGION /note="Necessary for transcriptional repression"
190-238 COILED ECO:0007744|PDB:6IQE"
1-299 DISORDER predicted by DISOPRED

MONOMER
299
pdb_id a1 identity[%]2 description
9o6s A 100.0 PHB2_HUMAN Prohibitin-2 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
299 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8rrh[50] A PHB1_HUMAN Prohibitin 1[272 aa] B 100.0
/100.0		 14
/14		 PHB2_HUMAN Prohibitin-2
8rrh[1] E PHB1_HUMAN Prohibitin 1[272 aa] B 100.0
/100.0		 1
/1		 PHB2_HUMAN Prohibitin-2
8rrh[16] A PHB1_HUMAN Prohibitin 1[272 aa] J 100.0
/100.0		 3
/3		 PHB2_HUMAN Prohibitin-2
9o6t[8] B PHB1_HUMAN Prohibitin 1[96 aa] A 100.0
/100.0		 49
/49		 PHB2_HUMAN Prohibitin-2
9o6t[4] X PHB1_HUMAN Prohibitin 1[96 aa] C 100.0
/100.0		 7
/7		 PHB2_HUMAN Prohibitin-2
8rrh[68] B PHB2_HUMAN Prohibitin-2[299 aa] A 43.8
/54.6		 16
/16		 PHB1_HUMAN Prohibitin 1
8rrh[1] J PHB2_HUMAN Prohibitin-2[299 aa] A 66.7
/54.6		 3
/4		 PHB1_HUMAN Prohibitin 1
9o6t[6] A PHB2_HUMAN Prohibitin-2[109 aa] B 45.8
/48.9		 48
/48		 PHB1_HUMAN Prohibitin 1
9o6t[3] E PHB2_HUMAN Prohibitin-2[109 aa] B 60.0
/48.9		 5
/7		 PHB1_HUMAN Prohibitin 1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
299 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6iqe[2] A PHB2_HUMAN Prohibitin-2[59 aa] A 100.0
/100.0		 17
/17		 PHB2_HUMAN Prohibitin-2
8j4i[6] B PHB2_HUMAN Prohibitin-2[190 aa] A 100.0
/100.0		 17
/17		 PHB2_HUMAN Prohibitin-2
8j4i[6] F PHB2_HUMAN Prohibitin-2[190 aa] A 100.0
/100.0		 19
/19		 PHB2_HUMAN Prohibitin-2
8rrh[2] D PHB2_HUMAN Prohibitin-2[299 aa] B 100.0
/100.0		 1
/1		 PHB2_HUMAN Prohibitin-2
8rrh[35] F PHB2_HUMAN Prohibitin-2[299 aa] B 100.0
/100.0		 1
/1		 PHB2_HUMAN Prohibitin-2
9o6s[25] U PHB2_HUMAN Prohibitin-2[299 aa] A 100.0
/100.0		 1
/1		 PHB2_HUMAN Prohibitin-2
9o6s[2] W PHB2_HUMAN Prohibitin-2[299 aa] S 100.0
/100.0		 1
/1		 PHB2_HUMAN Prohibitin-2
9o6t[1] K PHB2_HUMAN Prohibitin-2[299 aa] G 100.0
/100.0		 1
/1		 PHB2_HUMAN Prohibitin-2
9o6t[3] C PHB2_HUMAN Prohibitin-2[109 aa] A 100.0
/100.0		 26
/26		 PHB2_HUMAN Prohibitin-2
9o6t[2] E PHB2_HUMAN Prohibitin-2[109 aa] A 100.0
/100.0		 3
/3		 PHB2_HUMAN Prohibitin-2
9o6t[3] A PHB2_HUMAN Prohibitin-2[109 aa] C 100.0
/100.0		 17
/17		 PHB2_HUMAN Prohibitin-2
9o6t[1] A PHB2_HUMAN Prohibitin-2[109 aa] E 100.0
/100.0		 1
/1		 PHB2_HUMAN Prohibitin-2
8rrh[46] C PHB1_HUMAN Prohibitin 1[272 aa] A 0.0
/54.6		 1
/1		 PHB1_HUMAN Prohibitin 1
8rrh[1] K PHB1_HUMAN Prohibitin 1[272 aa] A 40.0
/54.6		 15
/15		 PHB1_HUMAN Prohibitin 1
8rrh[3] A PHB1_HUMAN Prohibitin 1[272 aa] C 0.0
/54.6		 1
/1		 PHB1_HUMAN Prohibitin 1
8rrh[1] A PHB1_HUMAN Prohibitin 1[272 aa] K 40.0
/54.6		 20
/20		 PHB1_HUMAN Prohibitin 1
9o6s[1] V PHB1_HUMAN Prohibitin 1[272 aa] T 100.0
/54.6		 1
/1		 PHB1_HUMAN Prohibitin 1
9o6t[8] D PHB1_HUMAN Prohibitin 1[96 aa] B 50.0
/48.9		 8
/13		 PHB1_HUMAN Prohibitin 1
9o6t[1] B PHB1_HUMAN Prohibitin 1[96 aa] T 100.0
/54.6		 1
/1		 PHB1_HUMAN Prohibitin 1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.