HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

3945060

1036

198

Q96P20(NLRP3_HUMAN)

RecName: Full=NACHT, LRR and PYD domains-containing protein 3 ; EC=3.6.4.- ;AltName: Full=Angiotensin/vasopressin receptor AII/AVP-like;AltName: Full=Caterpiller protein 1.1 ; Short=CLR1.1 ;AltName: Full=Cold-induced autoinflammatory syndrome 1 protein ;AltName: Full=Cryopyrin ;AltName: Full=PYRIN-containing APAF1-like protein 1 ;

QUERYSEQ

MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYRKYVRSRFQC
IEDRNARLGESVSLNKRYTRLRLIKEHRSQQEREQELLAIGKTKTCESPVSPIKMELLFDPDDEHSEPVHTVVFQGAAGIGKTILARKMMLDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCCPDPNPPIHKIVRKPSRILFL
MDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITTRPVALEKLQHLLDHPRHVEILGFSEAKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCTGLKQQMESGKSLAQTSKTTTAVYVFFLSSL
LQPRGGSQEHGLCAHLWGLCSLAADGIWNQKILFEESDLRNHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEKEGRTNVPGSRLKLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKI
SQQIRLELLKWIEVKAKAKKLQIQPSQLELFYCLYEMQEEDFVQRAMDYFPKIEINLSTRMDHMVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRHLDMVQCVLPSSSHAACSHGLVNSHLTSSFCRGLFSVLSTSQSLTELDLSD
NSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTSACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVC
CSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q96P20(NLRP3_HUMAN)]

1036
	region	name	description
	1-1036	CHAIN	/note="NACHT, LRR and PYD domains-containing protein 3" /id="PRO_0000080886"
	1-93	DOMAIN	/note="Pyrin"
	140-210	DOMAIN	/note="FISNA"
	220-536	DOMAIN	/note="NACHT"
	742-762	REPEAT	/note="LRR 1"
	771-792	REPEAT	/note="LRR 2"
	799-819	REPEAT	/note="LRR 3"
	828-849	REPEAT	/note="LRR 4"
	856-876	REPEAT	/note="LRR 5"
	885-906	REPEAT	/note="LRR 6"
	913-933	REPEAT	/note="LRR 7"
	942-963	REPEAT	/note="LRR 8"
	970-991	REPEAT	/note="LRR 9"
	131-134	REGION	/note="Required for binding to phosphatidylinositol 4- phosphate (PtdIns4P)"
	169-169	BINDING	/ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" ECO:0000305\|PubMed:36142182, ECO:0000305\|PubMed:36442502, ECO:0007744\|PDB:7VTP, ECO:0007744\|PDB:7ZGU, ECO:0007744\|PDB:8EJ4"
	226-234	BINDING	/ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" ECO:0000269\|PubMed:17483456, ECO:0000305\|PubMed:34687713, ECO:0000305\|PubMed:35114687, ECO:0000305\|PubMed:35254907, ECO:0000305\|PubMed:36142182, ECO:0000305\|PubMed:36442502, ECO:0007744\|PDB:7ALV, ECO:0007744\|PDB:7PZC, ECO:0007744\|PDB:7VTP, ECO:0007744\|PDB:7ZGU, ECO:0007744\|PDB:8EJ4"
	522-522	BINDING	/ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" ECO:0000305\|PubMed:35114687, ECO:0000305\|PubMed:35254907, ECO:0000305\|PubMed:36142182, ECO:0007744\|PDB:7ALV, ECO:0007744\|PDB:7PZC, ECO:0007744\|PDB:7VTP, ECO:0007744\|PDB:7ZGU"
	837-837	LIPID	/note="S-palmitoyl cysteine"
	838-838	LIPID	/note="S-palmitoyl cysteine"
	844-844	LIPID	/note="S-palmitoyl cysteine"
	1-702	DISORDER	predicted by DISOPRED

MONOMER

1036

pdb_id a¹ identity[%]² description

7pzc A 100.0 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

1036 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

8ej4[10] K NEK7_HUMAN Serine/threonine-protein kinase Nek7[261 aa] A 100.0
/100.0 13
/13 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8sxn[2] A NEK7_HUMAN Serine/threonine-protein kinase Nek7[284 aa] C 100.0
/100.0 44
/44 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

6npy[1] B E2AK2_HUMAN NEK7_HUMAN Protein kinase R,Serine/threonine-protein kinase N.. A 100.0
/99.6 29
/29 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7wge[1] B A0A2H1VFV3_SPOFR Thioredoxin[106 aa] A 35.7
/44.1 14
/14 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..

4per[1] B ANGI_CHICK Angiogenin[109 aa] A 9.5
/41.4 21
/28 Q5ZIY8_CHICK Ribonuclease Inhibitor

3tsr[4] A RNAS1_MOUSE Ribonuclease pancreatic[124 aa] E 17.6
/39.9 17
/23 RINI_MOUSE Ribonuclease inhibitor

1dfj[1] A RNAS1_BOVIN RIBONUCLEASE A[124 aa] B 22.7
/39.9 22
/28 RINI_PIG RIBONUCLEASE INHIBITOR

4peq[2] A RNAS1_BOVIN Ribonuclease pancreatic[124 aa] B 30.4
/38.4 23
/28 Q3SZN8_BOVIN Ribonuclease/angiogenin inhibitor 1

1a4y[2] B ANGI_HUMAN ANGIOGENIN[123 aa] A 12.5
/38.1 24
/33 RINI_HUMAN RIBONUCLEASE INHIBITOR

1z7x[4] A RNAS1_HUMAN Ribonuclease I[126 aa] B 22.2
/38.1 27
/32 RINI_HUMAN Ribonuclease inhibitor

2bex[2] C RNKD_HUMAN NONSECRETORY RIBONUCLEASE[135 aa] A 17.2
/38.1 29
/43 RINI_HUMAN RIBONUCLEASE INHIBITOR

8h93[5] B TLE6_MOUSE Transducin-like enhancer protein 6[367 aa] A 23.7
/34.6 38
/52 NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5

8h93[5] C OOEP_MOUSE Oocyte-expressed protein homolog[89 aa] A 25.0
/34.6 16
/22 NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5

6b5b[1] A BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e[1199 .. B 0.0
/27.9 11
/31 NLRC4_MOUSE NLR family CARD domain-containing protein 4

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

1036 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

4kxf[12] I ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 46.2
/27.8 13
/19 NLRC4_MOUSE NLR family CARD domain-containing protein 4

5irl[4] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 64.3
/30.4 14
/17 G1T469_RABIT Uncharacterized protein

6npy[11] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 100.0
/99.6 12
/12 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7alv[3] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 100.0
/100.0 18
/18 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtp[6] G ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 100.0
/100.0 16
/16 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtq[12] M ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 100.0
/85.9 18
/18 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

7wbt[2] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 69.2
/38.1 13
/19 NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9

7wbu[2] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 80.0
/38.2 10
/15 NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9

7zgu[6] G ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] A 100.0
/100.0 15
/15 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7alv[1] B RM5
1-[4-chloranyl-2,6-di(propan-2-yl)phenyl]-3-[4-(2-.. A 100.0
/100.0 18
/18 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzc[10] L 8GI
1-(1,2,3,5,6,7-hexahydro-s-indacen-4-yl)-3-[4-(2-o.. A 100.0
/100.0 15
/15 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtp[6] H 7YN
1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-.. A 100.0
/100.0 13
/13 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtq[12] N 7YN
1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-.. A 100.0
/85.9 12
/12 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

8swk[8] G 7YN
1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-.. A 100.0
/100.0 13
/13 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7wge[1] C AGS
PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom.. A 76.9
/44.1 13
/17 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..

8ej4[10] U AGS
PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom.. A 100.0
/100.0 19
/19 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8etr[1] D WTN
(6S,8R)-N-[(1,2,3,5,6,7-hexahydro-s-indacen-4-yl)c.. A 100.0
/100.0 14
/14 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8ri2[1] B A1H02
2-[4-chloranyl-9-oxidanylidene-12-(2-oxidanylpropa.. A 100.0
/100.0 16
/16 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8swk[8] H ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] A 100.0
/100.0 16
/16 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8wsm[1] D XE3
2-[[2-methyl-5-(trifluoromethyl)phenyl]amino]-~{N}.. A 100.0
/100.0 16
/16 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

2bex[1] F MAK
ALPHA-KETOMALONIC ACID[8 atoms] B 0.0
/38.1 5
/5 RINI_HUMAN RIBONUCLEASE INHIBITOR

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

1036 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7wge[1] D MG
MAGNESIUM ION[1 atoms] A 50.0
/44.1 2
/2 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..

8ej4[11] V MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 3
/3 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8wsm[1] B MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 1
/1 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

5y3s[1] F NA
SODIUM ION[1 atoms] A 42.9
/48.6 7
/7 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

4ewi[4] C CL
CHLORIDE ION[1 atoms] A 0.0
/34.6 2
/2 NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

1036 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7pzc[10] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88.. A 100.0
/100.0 13
/13 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzc[10] D NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88.. A 100.0
/100.0 7
/7 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzc[2] H NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[10.. A 100.0
/100.0 6
/6 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzc[2] H NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[10.. D 100.0
/100.0 2
/2 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzc[1] D NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88.. H 100.0
/100.0 4
/4 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzc[1] F NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88.. H 100.0
/100.0 7
/7 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzd[33] D NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[92.. A 100.0
/100.0 10
/10 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzd[33] F NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[92.. A 100.0
/100.0 5
/5 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzd[12] I NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[92.. A 100.0
/100.0 2
/2 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzd[15] A NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[92.. D 100.0
/100.0 8
/8 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7pzd[60] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[92.. D 100.0
/100.0 5
/5 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8ert[15] C NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[95.. A 100.0
/100.0 2
/2 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8ert[18] E NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[95.. A 100.0
/100.0 11
/11 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtp[6] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79.. A 100.0
/100.0 5
/5 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtp[6] C NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79.. A 100.0
/100.0 7
/7 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7vtp[6] E NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79.. A 100.0
/100.0 9
/9 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7zgu[12] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80.. A 100.0
/100.0 8
/8 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7zgu[6] C NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80.. A 100.0
/100.0 8
/8 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7zgu[6] E NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80.. A 100.0
/100.0 9
/9 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8ej4[10] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[85.. A 100.0
/100.0 17
/17 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8ej4[10] J NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[85.. A 100.0
/100.0 18
/18 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8swf[4] D NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[83.. A 100.0
/100.0 23
/23 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8swf[4] E NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[83.. A 100.0
/100.0 14
/14 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8swf[16] H NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[83.. A 100.0
/100.0 9
/9 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8swf[4] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[83.. C 100.0
/100.0 18
/18 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8swf[4] F NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[83.. C 100.0
/100.0 11
/11 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

8swk[6] F NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[81.. A 100.0
/100.0 4
/6 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3

7lfh[12] B NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[80.. A 83.3
/85.7 6
/6 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

7lfh[12] L NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[80.. A 80.0
/85.7 20
/20 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

7vtq[12] G NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[78.. A 88.9
/85.9 9
/9 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

7vtq[12] H NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[78.. A 88.2
/85.9 17
/17 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3

4im6[2] A NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[19.. A 46.7
/48.3 15
/15 NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

4xhs[2] B MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and.. A 33.3
/46.7 6
/11 MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..

4n1j[17] B NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[9.. A 37.5
/40.8 16
/16 NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14

4n1j[1] B NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[9.. D 20.0
/40.7 5
/5 NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14

4n1k[4] C NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[8.. A 100.0
/40.5 2
/10 NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14

7wbt[2] B NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9[89.. A 26.3
/38.1 19
/31 NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9

1a4y[6] C RINI_HUMAN RIBONUCLEASE INHIBITOR[460 aa] A 14.3
/38.1 14
/33 RINI_HUMAN RIBONUCLEASE INHIBITOR

8h93[2] D NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5[94.. A 25.0
/34.6 8
/8 NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5

4ewi[2] A NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[91.. A 33.3
/34.6 6
/10 NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4

4ewi[4] B NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[90.. A 35.3
/34.6 17
/23 NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4

4ewi[2] B NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[90.. A 0.0
/34.6 5
/5 NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4

5irm[1] B G1T469_RABIT Uncharacterized protein[770 aa] A 27.3
/30.0 22
/23 G1T469_RABIT Uncharacterized protein

5irm[1] A G1T469_RABIT Uncharacterized protein[767 aa] B 5.9
/30.1 17
/17 G1T469_RABIT Uncharacterized protein

3jbl[11] B NLRC4_MOUSE NLR family CARD domain-containing protein 4[909 aa.. A 14.3
/27.9 7
/17 NLRC4_MOUSE NLR family CARD domain-containing protein 4

3jbl[11] K NLRC4_MOUSE NLR family CARD domain-containing protein 4[909 aa.. A 0.0
/27.9 7
/27 NLRC4_MOUSE NLR family CARD domain-containing protein 4

4kxf[11] A NLRC4_MOUSE NLR family CARD domain-containing protein 4[904 aa.. A 28.0
/27.8 25
/33 NLRC4_MOUSE NLR family CARD domain-containing protein 4

4kxf[11] H NLRC4_MOUSE NLR family CARD domain-containing protein 4[866 aa.. A 28.6
/27.8 7
/8 NLRC4_MOUSE NLR family CARD domain-containing protein 4

4kxf[12] H NLRC4_MOUSE NLR family CARD domain-containing protein 4[866 aa.. A 33.3
/27.8 3
/19 NLRC4_MOUSE NLR family CARD domain-containing protein 4

6b5b[1] C NLRC4_MOUSE NLR family CARD domain-containing protein 4[903 aa.. B 9.1
/27.9 11
/22 NLRC4_MOUSE NLR family CARD domain-containing protein 4

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

1036 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

4im6[2] B GOL
GLYCEROL[6 atoms] A 100.0
/48.3 4
/4 NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

4im6[2] B GOL
GLYCEROL[6 atoms] A 66.7
/48.3 3
/3 NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

4n1j[5] E GOL
GLYCEROL[6 atoms] A 25.0
/40.8 4
/4 NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14

8zgd[1] B GOL
GLYCEROL[6 atoms] A 100.0
/50.3 4
/4 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..

5y3s[1] E PO4
PHOSPHATE ION[5 atoms] A 50.0
/48.6 2
/2 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

5y3s[1] G PO4
PHOSPHATE ION[5 atoms] C 0.0
/48.0 1
/1 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1

4xhs[1] F FMT
FORMIC ACID[3 atoms] A 0.0
/46.7 4
/4 MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..

1dfj[1] C SO4
SULFATE ION[5 atoms] B 0.0
/39.9 2
/2 RINI_PIG RIBONUCLEASE INHIBITOR

4ewi[2] E SO4
SULFATE ION[5 atoms] B 0.0
/34.6 3
/3 NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4

4kxf[1] K SO4
SULFATE ION[5 atoms] B 0.0
/27.9 4
/4 NLRC4_MOUSE NLR family CARD domain-containing protein 4

4r5d[1] F SO4
SULFATE ION[5 atoms] A 40.0
/35.3 5
/5 Leucine rich repeat protein

5h7n[1] F SO4
SULFATE ION[5 atoms] A 0.0
/46.2 3
/3 NLRP12-PYD with MBP tag

5h7n[1] K SO4
SULFATE ION[5 atoms] B 66.7
/43.4 3
/3 NLRP12-PYD with MBP tag

3tsr[3] K EDO
1,2-ETHANEDIOL[4 atoms] E 20.0
/39.9 5
/5 RINI_MOUSE Ribonuclease inhibitor

3tsr[2] R EDO
1,2-ETHANEDIOL[4 atoms] G 0.0
/39.9 2
/2 RINI_MOUSE Ribonuclease inhibitor

4r5d[1] G EDO
1,2-ETHANEDIOL[4 atoms] A 50.0
/35.3 2
/2 Leucine rich repeat protein

5h7n[2] I EDO
1,2-ETHANEDIOL[4 atoms] A 20.0
/46.2 5
/5 NLRP12-PYD with MBP tag

5h7n[1] Q EDO
1,2-ETHANEDIOL[4 atoms] B 50.0
/43.4 2
/2 NLRP12-PYD with MBP tag

3tsr[1] J PEG
DI(HYDROXYETHYL)ETHER[7 atoms] E 33.3
/39.9 3
/3 RINI_MOUSE Ribonuclease inhibitor

1z7x[2] E CIT
CITRIC ACID[13 atoms] B 0.0
/38.1 2
/3 RINI_HUMAN Ribonuclease inhibitor

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
1036
	pdb_id	a¹	identity[%]²	description
	7pzc	A	100.0	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
1036	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	8ej4[10]	K	NEK7_HUMAN Serine/threonine-protein kinase Nek7[261 aa]	A	100.0 /100.0	13 /13	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8sxn[2]	A	NEK7_HUMAN Serine/threonine-protein kinase Nek7[284 aa]	C	100.0 /100.0	44 /44	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	6npy[1]	B	E2AK2_HUMAN NEK7_HUMAN Protein kinase R,Serine/threonine-protein kinase N..	A	100.0 /99.6	29 /29	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7wge[1]	B	A0A2H1VFV3_SPOFR Thioredoxin[106 aa]	A	35.7 /44.1	14 /14	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..
	4per[1]	B	ANGI_CHICK Angiogenin[109 aa]	A	9.5 /41.4	21 /28	Q5ZIY8_CHICK Ribonuclease Inhibitor
	3tsr[4]	A	RNAS1_MOUSE Ribonuclease pancreatic[124 aa]	E	17.6 /39.9	17 /23	RINI_MOUSE Ribonuclease inhibitor
	1dfj[1]	A	RNAS1_BOVIN RIBONUCLEASE A[124 aa]	B	22.7 /39.9	22 /28	RINI_PIG RIBONUCLEASE INHIBITOR
	4peq[2]	A	RNAS1_BOVIN Ribonuclease pancreatic[124 aa]	B	30.4 /38.4	23 /28	Q3SZN8_BOVIN Ribonuclease/angiogenin inhibitor 1
	1a4y[2]	B	ANGI_HUMAN ANGIOGENIN[123 aa]	A	12.5 /38.1	24 /33	RINI_HUMAN RIBONUCLEASE INHIBITOR
	1z7x[4]	A	RNAS1_HUMAN Ribonuclease I[126 aa]	B	22.2 /38.1	27 /32	RINI_HUMAN Ribonuclease inhibitor
	2bex[2]	C	RNKD_HUMAN NONSECRETORY RIBONUCLEASE[135 aa]	A	17.2 /38.1	29 /43	RINI_HUMAN RIBONUCLEASE INHIBITOR
	8h93[5]	B	TLE6_MOUSE Transducin-like enhancer protein 6[367 aa]	A	23.7 /34.6	38 /52	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5
	8h93[5]	C	OOEP_MOUSE Oocyte-expressed protein homolog[89 aa]	A	25.0 /34.6	16 /22	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5
	6b5b[1]	A	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e[1199 ..	B	0.0 /27.9	11 /31	NLRC4_MOUSE NLR family CARD domain-containing protein 4
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1036	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	4kxf[12]	I	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	46.2 /27.8	13 /19	NLRC4_MOUSE NLR family CARD domain-containing protein 4
	5irl[4]	B	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	64.3 /30.4	14 /17	G1T469_RABIT Uncharacterized protein
	6npy[11]	C	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	100.0 /99.6	12 /12	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7alv[3]	C	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	100.0 /100.0	18 /18	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtp[6]	G	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	100.0 /100.0	16 /16	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtq[12]	M	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	100.0 /85.9	18 /18	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	7wbt[2]	C	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	69.2 /38.1	13 /19	NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9
	7wbu[2]	B	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	80.0 /38.2	10 /15	NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9
	7zgu[6]	G	ADP ADENOSINE-5'-DIPHOSPHATE[27 atoms]	A	100.0 /100.0	15 /15	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7alv[1]	B	RM5 1-[4-chloranyl-2,6-di(propan-2-yl)phenyl]-3-[4-(2-..	A	100.0 /100.0	18 /18	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzc[10]	L	8GI 1-(1,2,3,5,6,7-hexahydro-s-indacen-4-yl)-3-[4-(2-o..	A	100.0 /100.0	15 /15	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtp[6]	H	7YN 1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-..	A	100.0 /100.0	13 /13	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtq[12]	N	7YN 1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-..	A	100.0 /85.9	12 /12	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	8swk[8]	G	7YN 1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-..	A	100.0 /100.0	13 /13	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7wge[1]	C	AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom..	A	76.9 /44.1	13 /17	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..
	8ej4[10]	U	AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom..	A	100.0 /100.0	19 /19	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8etr[1]	D	WTN (6S,8R)-N-[(1,2,3,5,6,7-hexahydro-s-indacen-4-yl)c..	A	100.0 /100.0	14 /14	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8ri2[1]	B	A1H02 2-[4-chloranyl-9-oxidanylidene-12-(2-oxidanylpropa..	A	100.0 /100.0	16 /16	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8swk[8]	H	ATP ADENOSINE-5'-TRIPHOSPHATE[31 atoms]	A	100.0 /100.0	16 /16	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8wsm[1]	D	XE3 2-[[2-methyl-5-(trifluoromethyl)phenyl]amino]-~{N}..	A	100.0 /100.0	16 /16	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	2bex[1]	F	MAK ALPHA-KETOMALONIC ACID[8 atoms]	B	0.0 /38.1	5 /5	RINI_HUMAN RIBONUCLEASE INHIBITOR
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1036	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7wge[1]	D	MG MAGNESIUM ION[1 atoms]	A	50.0 /44.1	2 /2	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..
	8ej4[11]	V	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	3 /3	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8wsm[1]	B	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	1 /1	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	5y3s[1]	F	NA SODIUM ION[1 atoms]	A	42.9 /48.6	7 /7	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	4ewi[4]	C	CL CHLORIDE ION[1 atoms]	A	0.0 /34.6	2 /2	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1036	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7pzc[10]	B	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88..	A	100.0 /100.0	13 /13	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzc[10]	D	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88..	A	100.0 /100.0	7 /7	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzc[2]	H	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[10..	A	100.0 /100.0	6 /6	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzc[2]	H	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[10..	D	100.0 /100.0	2 /2	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzc[1]	D	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88..	H	100.0 /100.0	4 /4	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzc[1]	F	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88..	H	100.0 /100.0	7 /7	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzd[33]	D	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[92..	A	100.0 /100.0	10 /10	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzd[33]	F	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[92..	A	100.0 /100.0	5 /5	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzd[12]	I	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[92..	A	100.0 /100.0	2 /2	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzd[15]	A	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[92..	D	100.0 /100.0	8 /8	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7pzd[60]	B	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[92..	D	100.0 /100.0	5 /5	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8ert[15]	C	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[95..	A	100.0 /100.0	2 /2	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8ert[18]	E	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[95..	A	100.0 /100.0	11 /11	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtp[6]	B	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79..	A	100.0 /100.0	5 /5	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtp[6]	C	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79..	A	100.0 /100.0	7 /7	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7vtp[6]	E	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79..	A	100.0 /100.0	9 /9	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7zgu[12]	B	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80..	A	100.0 /100.0	8 /8	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7zgu[6]	C	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80..	A	100.0 /100.0	8 /8	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7zgu[6]	E	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80..	A	100.0 /100.0	9 /9	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8ej4[10]	B	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[85..	A	100.0 /100.0	17 /17	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8ej4[10]	J	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[85..	A	100.0 /100.0	18 /18	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8swf[4]	D	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[83..	A	100.0 /100.0	23 /23	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8swf[4]	E	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[83..	A	100.0 /100.0	14 /14	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8swf[16]	H	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[83..	A	100.0 /100.0	9 /9	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8swf[4]	B	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[83..	C	100.0 /100.0	18 /18	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8swf[4]	F	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[83..	C	100.0 /100.0	11 /11	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	8swk[6]	F	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[81..	A	100.0 /100.0	4 /6	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
	7lfh[12]	B	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[80..	A	83.3 /85.7	6 /6	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	7lfh[12]	L	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[80..	A	80.0 /85.7	20 /20	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	7vtq[12]	G	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[78..	A	88.9 /85.9	9 /9	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	7vtq[12]	H	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[78..	A	88.2 /85.9	17 /17	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
	4im6[2]	A	NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1[19..	A	46.7 /48.3	15 /15	NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	4xhs[2]	B	MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..	A	33.3 /46.7	6 /11	MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..
	4n1j[17]	B	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[9..	A	37.5 /40.8	16 /16	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14
	4n1j[1]	B	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[9..	D	20.0 /40.7	5 /5	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14
	4n1k[4]	C	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14[8..	A	100.0 /40.5	2 /10	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14
	7wbt[2]	B	NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9[89..	A	26.3 /38.1	19 /31	NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9
	1a4y[6]	C	RINI_HUMAN RIBONUCLEASE INHIBITOR[460 aa]	A	14.3 /38.1	14 /33	RINI_HUMAN RIBONUCLEASE INHIBITOR
	8h93[2]	D	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5[94..	A	25.0 /34.6	8 /8	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5
	4ewi[2]	A	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[91..	A	33.3 /34.6	6 /10	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4
	4ewi[4]	B	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[90..	A	35.3 /34.6	17 /23	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4
	4ewi[2]	B	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4[90..	A	0.0 /34.6	5 /5	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4
	5irm[1]	B	G1T469_RABIT Uncharacterized protein[770 aa]	A	27.3 /30.0	22 /23	G1T469_RABIT Uncharacterized protein
	5irm[1]	A	G1T469_RABIT Uncharacterized protein[767 aa]	B	5.9 /30.1	17 /17	G1T469_RABIT Uncharacterized protein
	3jbl[11]	B	NLRC4_MOUSE NLR family CARD domain-containing protein 4[909 aa..	A	14.3 /27.9	7 /17	NLRC4_MOUSE NLR family CARD domain-containing protein 4
	3jbl[11]	K	NLRC4_MOUSE NLR family CARD domain-containing protein 4[909 aa..	A	0.0 /27.9	7 /27	NLRC4_MOUSE NLR family CARD domain-containing protein 4
	4kxf[11]	A	NLRC4_MOUSE NLR family CARD domain-containing protein 4[904 aa..	A	28.0 /27.8	25 /33	NLRC4_MOUSE NLR family CARD domain-containing protein 4
	4kxf[11]	H	NLRC4_MOUSE NLR family CARD domain-containing protein 4[866 aa..	A	28.6 /27.8	7 /8	NLRC4_MOUSE NLR family CARD domain-containing protein 4
	4kxf[12]	H	NLRC4_MOUSE NLR family CARD domain-containing protein 4[866 aa..	A	33.3 /27.8	3 /19	NLRC4_MOUSE NLR family CARD domain-containing protein 4
	6b5b[1]	C	NLRC4_MOUSE NLR family CARD domain-containing protein 4[903 aa..	B	9.1 /27.9	11 /22	NLRC4_MOUSE NLR family CARD domain-containing protein 4
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1036	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	4im6[2]	B	GOL GLYCEROL[6 atoms]	A	100.0 /48.3	4 /4	NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	4im6[2]	B	GOL GLYCEROL[6 atoms]	A	66.7 /48.3	3 /3	NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	4n1j[5]	E	GOL GLYCEROL[6 atoms]	A	25.0 /40.8	4 /4	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14
	8zgd[1]	B	GOL GLYCEROL[6 atoms]	A	100.0 /50.3	4 /4	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..
	5y3s[1]	E	PO4 PHOSPHATE ION[5 atoms]	A	50.0 /48.6	2 /2	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	5y3s[1]	G	PO4 PHOSPHATE ION[5 atoms]	C	0.0 /48.0	1 /1	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1
	4xhs[1]	F	FMT FORMIC ACID[3 atoms]	A	0.0 /46.7	4 /4	MALE_ECO57 NAL12_HUMAN Maltose-binding periplasmic protein,NACHT, LRR and..
	1dfj[1]	C	SO4 SULFATE ION[5 atoms]	B	0.0 /39.9	2 /2	RINI_PIG RIBONUCLEASE INHIBITOR
	4ewi[2]	E	SO4 SULFATE ION[5 atoms]	B	0.0 /34.6	3 /3	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4
	4kxf[1]	K	SO4 SULFATE ION[5 atoms]	B	0.0 /27.9	4 /4	NLRC4_MOUSE NLR family CARD domain-containing protein 4
	4r5d[1]	F	SO4 SULFATE ION[5 atoms]	A	40.0 /35.3	5 /5	Leucine rich repeat protein
	5h7n[1]	F	SO4 SULFATE ION[5 atoms]	A	0.0 /46.2	3 /3	NLRP12-PYD with MBP tag
	5h7n[1]	K	SO4 SULFATE ION[5 atoms]	B	66.7 /43.4	3 /3	NLRP12-PYD with MBP tag
	3tsr[3]	K	EDO 1,2-ETHANEDIOL[4 atoms]	E	20.0 /39.9	5 /5	RINI_MOUSE Ribonuclease inhibitor
	3tsr[2]	R	EDO 1,2-ETHANEDIOL[4 atoms]	G	0.0 /39.9	2 /2	RINI_MOUSE Ribonuclease inhibitor
	4r5d[1]	G	EDO 1,2-ETHANEDIOL[4 atoms]	A	50.0 /35.3	2 /2	Leucine rich repeat protein
	5h7n[2]	I	EDO 1,2-ETHANEDIOL[4 atoms]	A	20.0 /46.2	5 /5	NLRP12-PYD with MBP tag
	5h7n[1]	Q	EDO 1,2-ETHANEDIOL[4 atoms]	B	50.0 /43.4	2 /2	NLRP12-PYD with MBP tag
	3tsr[1]	J	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	E	33.3 /39.9	3 /3	RINI_MOUSE Ribonuclease inhibitor
	1z7x[2]	E	CIT CITRIC ACID[13 atoms]	B	0.0 /38.1	2 /3	RINI_HUMAN Ribonuclease inhibitor
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [Q96P20(NLRP3_HUMAN)]