Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1695434 866 28 Q96F46(I17RA_HUMAN) RecName: Full=Interleukin-17 receptor A ; Short=IL-17 receptor A; Short=IL-17RA;AltName: Full=CDw217;AltName: CD_antigen=CD217;Flags: Precursor;
QUERYSEQ 
MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPGLNCTVKNSTCLDDSWIHPRNLTPSSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLNTNERLCVRFEFLSKLRHHHRRWRFTFSHFV
VDPDQEYEVTVHHLPKPIPDGDPNHQSKNFLVPDCEHARMKVTTPCMSSGSLWDPNITVETLEAHQLRVSFTLWNESTHYQILLTSFPHMENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQVQIQPFFSSCLNDCLRHSAT
VSCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGPGSEKYSDDTKYTDGLPAADLIPPPLKPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAISEAGVMTWVGRQKQEMVESNSKIIVLCSRG
TRAKWQALLGRGAPVRLRCDHGKPVGDLFTAAMNMILPDFKRPACFGTYVVCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVYFRIQDLEMFQPGRMHRVGELSGDNYLRSPGGRQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPS
LDEEVFEEPLLPPGTGIVKRAPLVREPGSQACLAIDPLVGEEGGAAVAKLEPHLQPRGQPAPQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEGEACPLLGSPGAGRNSVLFLPVDPEDSPLGSSTPMASPDLLPEDVREHLEG
LMLSLFEQSLSCQAQGGCSRPAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQRQLLFRQLQKNSGWDTMGSESEGPSA
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q96F46(I17RA_HUMAN)]

866
region name description
1-32 SIGNAL
33-866 CHAIN /note="Interleukin-17 receptor A" /id="PRO_0000011030"
33-320 TOPO_DOM /note="Extracellular"
321-341 TRANSMEM /note="Helical"
342-866 TOPO_DOM /note="Cytoplasmic"
377-534 DOMAIN /note="SEFIR"
717-736 REGION /note="Disordered"
773-840 REGION /note="Disordered"
787-805 COMPBIAS /note="Polar residues"
1-866 DISORDER predicted by DISOPRED

MONOMER
866
pdb_id a1 identity[%]2 description
7zan C 98.9 I17RA_HUMAN Interleukin-17 receptor A
4nux A 100.0 I17RA_HUMAN Interleukin-17 receptor A 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
866 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3jvf[1] A IL17F_HUMAN Interleukin-17F[104 aa] C 100.0
/100.0		 16
/16		 I17RA_HUMAN Interleukin-17 receptor A
3jvf[3] B IL17F_HUMAN Interleukin-17F[104 aa] C 100.0
/100.0		 24
/24		 I17RA_HUMAN Interleukin-17 receptor A
7uwl[2] C I17RB_HUMAN Interleukin-17 receptor B[250 aa] E 100.0
/100.0		 10
/10		 I17RA_HUMAN Interleukin-17 receptor A
7uwn[1] E IL17_HUMAN Interleukin-17A[93 aa] F 100.0
/100.0		 24
/24		 I17RA_HUMAN Interleukin-17 receptor A
4hsa[17] A IL17_HUMAN Interleukin-17A[104 aa] C 100.0
/99.3		 19
/19		 I17RA_HUMAN Interleukin-17 receptor A
7wg3[4] A Light chain of D9 Fab[213 aa] I 36.4
/29.6		 11
/11		 A3KN55_BOVIN IL17RB protein
7wg3[2] C Light chain of D9 Fab[213 aa] I 40.0
/29.6		 5
/5		 A3KN55_BOVIN IL17RB protein
7wg3[3] A Light chain of D9 Fab[213 aa] J 50.0
/29.6		 2
/5		 A3KN55_BOVIN IL17RB protein
7wg3[4] E Heavy chain of D9 Fab[220 aa] I 20.0
/29.6		 5
/5		 A3KN55_BOVIN IL17RB protein
7uwj[4] A IL25_HUMAN Interleukin-25[94 aa] B 16.7
/28.4		 18
/18		 I17RB_HUMAN Interleukin-17 receptor B
7uwj[4] C IL25_HUMAN Interleukin-25[94 aa] B 37.5
/28.4		 16
/16		 I17RB_HUMAN Interleukin-17 receptor B
7uwk[6] A IL25_HUMAN Interleukin-25[96 aa] B 26.7
/28.6		 15
/15		 I17RB_HUMAN Interleukin-17 receptor B
7uwk[6] C IL25_HUMAN Interleukin-25[100 aa] B 33.3
/28.6		 12
/12		 I17RB_HUMAN Interleukin-17 receptor B
7uwl[2] E I17RA_HUMAN Interleukin-17 receptor A[271 aa] C 30.0
/29.3		 10
/10		 I17RB_HUMAN Interleukin-17 receptor B
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
866 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3jvf[9] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		C 100.0
/100.0		 2
/2		 I17RA_HUMAN Interleukin-17 receptor A
3jvf[5] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		C 100.0
/100.0		 1
/1		 I17RA_HUMAN Interleukin-17 receptor A
3jvf[1] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		C 100.0
/100.0		 1
/1		 I17RA_HUMAN Interleukin-17 receptor A
3jvf[9] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		C 100.0
/100.0		 3
/3		 I17RA_HUMAN Interleukin-17 receptor A
3jvf[25] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		C 100.0
/100.0		 2
/2		 I17RA_HUMAN Interleukin-17 receptor A
5n9b[1] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/100.0		 1
/1		 I17RA_HUMAN Interleukin-17 receptor A
7uwj[6] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		B 20.0
/28.4		 5
/5		 I17RB_HUMAN Interleukin-17 receptor B
7uwl[2] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		C 0.0
/29.3		 3
/3		 I17RB_HUMAN Interleukin-17 receptor B
7uwl[2] U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		E 100.0
/100.0		 2
/2		 I17RA_HUMAN Interleukin-17 receptor A
7uwm[3] N NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		F 100.0
/100.0		 3
/3		 I17RA_HUMAN Interleukin-17 receptor A
7wg3[1] EA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		I 0.0
/29.6		 2
/2		 A3KN55_BOVIN IL17RB protein
7wg3[4] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		I 66.7
/29.6		 3
/3		 A3KN55_BOVIN IL17RB protein
7wg3[1] AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		J 0.0
/29.6		 1
/1		 A3KN55_BOVIN IL17RB protein
7wg3[1] Z NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		J 0.0
/29.6		 3
/3		 A3KN55_BOVIN IL17RB protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
866 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3jvf[1] E CA
CALCIUM ION[1 atoms] 		C 100.0
/100.0		 2
/2		 I17RA_HUMAN Interleukin-17 receptor A
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
866 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7uwl[2] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 20.0
/29.3		 5
/5		 I17RB_HUMAN Interleukin-17 receptor B
7uwl[2] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 50.0
/29.3		 2
/2		 I17RB_HUMAN Interleukin-17 receptor B
7uwm[1] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0		 3
/3		 I17RA_HUMAN Interleukin-17 receptor A
7uwn[1] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0		 3
/3		 I17RA_HUMAN Interleukin-17 receptor A
4hsa[1] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. C 100.0
/99.3		 5
/5		 I17RA_HUMAN Interleukin-17 receptor A
4hsa[1] I alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. C 100.0
/99.3		 1
/1		 I17RA_HUMAN Interleukin-17 receptor A
4hsa[2] G alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. C 100.0
/99.3		 5
/5		 I17RA_HUMAN Interleukin-17 receptor A
7wg3[1] M alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. I 16.7
/29.6		 6
/8		 A3KN55_BOVIN IL17RB protein
7wg3[1] N alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. J 0.0
/29.6		 6
/7		 A3KN55_BOVIN IL17RB protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
866 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7uwn[1] F I17RA_HUMAN Interleukin-17 receptor A[237 aa] C 100.0
/100.0		 15
/15		 I17RA_HUMAN Interleukin-17 receptor A
7uwm[5] F I17RA_HUMAN Interleukin-17 receptor A[262 aa] C 100.0
/100.0		 13
/13		 I17RA_HUMAN Interleukin-17 receptor A
7wg3[2] L A3KN55_BOVIN IL17RB protein[236 aa] I 0.0
/29.6		 4
/8		 A3KN55_BOVIN IL17RB protein
7wg3[1] J A3KN55_BOVIN IL17RB protein[245 aa] K 53.8
/29.5		 13
/15		 A3KN55_BOVIN IL17RB protein
7wg3[1] I A3KN55_BOVIN IL17RB protein[248 aa] L 20.0
/29.9		 10
/10		 A3KN55_BOVIN IL17RB protein
7uwk[4] H I17RB_HUMAN Interleukin-17 receptor B[244 aa] B 50.0
/28.6		 8
/8		 I17RB_HUMAN Interleukin-17 receptor B
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.