Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4054253 678 219 Q96C10(DHX58_HUMAN) RecName: Full=ATP-dependent RNA helicase DHX58 ; EC=3.6.4.13 ;AltName: Full=ATP-dependent helicase LGP2 ;AltName: Full=Protein D11Lgp2 homolog;AltName: Full=RIG-I-like receptor 3; Short=RLR-3;AltName: Full=RIG-I-like receptor LGP2; Short=RLR;
QUERYSEQ
MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDTVYNVIMSQYL
ELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAV
DALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPKLEMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQQEVIQKFQDGTLNLLVATSVAEEGLDIPHC
NVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKV
FKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q96C10(DHX58_HUMAN)]

678
region name description
1-678 CHAIN /note="ATP-dependent RNA helicase DHX58" /id="PRO_0000102010"
11-188 DOMAIN /note="Helicase ATP-binding"
350-514 DOMAIN /note="Helicase C-terminal"
539-669 DOMAIN /note="RLR CTR"
572-655 REGION /note="RNA-binding"
489-546 COILED
24-31 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616"
556-556 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
559-559 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
612-612 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
615-615 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
510-678 DISORDER predicted by DISOPRED

MONOMER
678
pdb_id a1 identity[%]2 description
5jb2 A 53.2 G0YYQ5_CHICK LGP2
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
678 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4i1s[1] B V_SV5 Non-structural protein V[52 aa] A 68.0
/45.0
25
/26
A7LCX1_PIG A7LCX1_PIG Melanoma differentiation associated protein-5
7jl0[4] D TRI65_HUMAN Tripartite motif-containing protein 65[180 aa] C 10.0
/44.9
10
/11
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
6p4o[3] B Q970I1_SULTO Endonuclease Bax1[479 aa] A 32.0
/37.7
25
/27
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4f[4] B Q970I1_SULTO Endonuclease Bax1[373 aa] A 26.1
/37.7
23
/23
Q970I2_SULTO DNA-dependent ATPase XPBII
7jl1[4] D RN135_HUMAN E3 ubiquitin-protein ligase RNF135[171 aa] A 20.0
/35.6
10
/10
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7jl3[2] D RN135_HUMAN E3 ubiquitin-protein ligase RNF135[169 aa] A 0.0
/35.6
1
/1
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[6] B RN135_HUMAN E3 ubiquitin-protein ligase RNF135[178 aa] A 16.7
/34.7
12
/13
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7v[1] B RN135_HUMAN E3 ubiquitin-protein ligase RNF135[178 aa] C 0.0
/34.3
1
/1
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
2yjt[1] A D8AM26_ECOLX REGULATOR OF RIBONUCLEASE ACTIVITY A[158 aa] D 28.6
/31.0
14
/17
SRMB_ECOLI ATP-DEPENDENT RNA HELICASE SRMB
7w0a[8] B M9MRT5_DROME Loquacious, isoform D[16 aa] A 33.3
/31.0
6
/27
A1ZAW0_DROME Dicer-2, isoform A
7w0d[1] C M9MRT5_DROME Loquacious, isoform D[13 aa] E 14.3
/31.0
7
/25
A1ZAW0_DROME Dicer-2, isoform A
8hf0[4] C Q9VLW8_DROME LD06392p[126 aa] A 0.0
/31.0
1
/31
A1ZAW0_DROME Dicer-2, isoform A
8hf0[3] C Q9VLW8_DROME LD06392p[126 aa] D 100.0
/31.0
1
/11
A1ZAW0_DROME Dicer-2, isoform A
8hf1[1] B M9MRT5_DROME Loquacious, isoform D[16 aa] A 22.2
/31.0
9
/23
A1ZAW0_DROME Dicer-2, isoform A
6yvh[1] E CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[272 aa] H 25.0
/29.0
4
/21
IF4A3_HUMAN Eukaryotic initiation factor 4A-III
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
678 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3eqt[2] C 5'-R(*GP*CP*GP*CP*GP*CP*GP*C)-3' A 100.0
/100.0
15
/15
DHX58_HUMAN ATP-dependent RNA helicase DHX58
3eqt[2] D 5'-R(*GP*CP*GP*CP*GP*CP*GP*C)-3' A 100.0
/100.0
6
/6
DHX58_HUMAN ATP-dependent RNA helicase DHX58
5jaj[1] B RNA (5'-R(P*GP*GP*UP*AP*CP*GP*UP*AP*CP*CP*C)-3') A 42.3
/53.9
26
/26
G0YYQ5_CHICK LGP2
5jbg[1] B RNA (5'-R(*GPPP*GP*AP*GP*CP*GP*UP*GP*CP*CP*GP*GP*G.. A 47.8
/53.4
67
/67
G0YYQ5_CHICK LGP2
5jbj[1] B RNA (5'-R(P*GP*GP*UP*AP*GP*CP*GP*CP*UP*AP*CP*C)-3'.. A 38.5
/53.2
26
/26
G0YYQ5_CHICK LGP2
5jbj[1] C RNA (5'-R(P*GP*GP*UP*AP*GP*CP*GP*CP*UP*AP*CP*C)-3'.. A 67.6
/53.2
34
/34
G0YYQ5_CHICK LGP2
5jb2[1] B RNA (5'-R(*GPPP*GP*UP*AP*CP*GP*UP*AP*CP*CP*C)-3') .. A 42.3
/53.2
26
/26
G0YYQ5_CHICK LGP2
5jb2[1] C RNA (5'-R(*GPPP*GP*UP*AP*CP*GP*UP*AP*CP*C)-3') A 63.9
/53.2
36
/36
G0YYQ5_CHICK LGP2
4gl2[2] C RNA (5'-R(*AP*UP*CP*CP*GP*CP*GP*GP*CP*CP*CP*U)-3').. A 57.1
/47.2
14
/14
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
4gl2[2] F RNA (5'-R(P*AP*GP*GP*GP*CP*CP*GP*CP*GP*GP*AP*U)-3'.. A 69.0
/47.2
29
/29
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
5jc7[1] C RNA (5'-R(P*GP*GP*AP*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP.. A 50.0
/45.3
20
/20
D9N195_CHICK Melanoma differentiation associated protein-5
5jc7[1] C RNA (5'-R(P*GP*GP*AP*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP.. B 63.3
/45.4
30
/30
D9N195_CHICK Melanoma differentiation associated protein-5
5jc7[1] D RNA (5'-R(P*GP*GP*GP*AP*CP*GP*UP*CP*AP*UP*GP*CP*GP.. A 64.5
/45.3
31
/31
D9N195_CHICK Melanoma differentiation associated protein-5
5jc7[1] D RNA (5'-R(P*GP*GP*GP*AP*CP*GP*UP*CP*AP*UP*GP*CP*GP.. B 47.4
/45.4
19
/19
D9N195_CHICK Melanoma differentiation associated protein-5
7jl2[3] A RNA (44-MER) C 57.1
/44.9
14
/14
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl2[3] B RNA (44-MER) C 57.1
/44.9
21
/21
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
5jaj[1] C RNA (5'-R(P*GP*GP*UP*AP*CP*GP*UP*AP*CP*C)-3') A 62.2
/53.9
37
/37
G0YYQ5_CHICK LGP2
5jc3[6] B RNA (5'-R(P*GP*GP*UP*AP*CP*GP*UP*AP*CP*C)-3') A 50.0
/43.9
20
/20
D9N195_CHICK Melanoma differentiation associated protein-5
5jc3[5] C RNA (5'-R(P*GP*GP*UP*AP*CP*GP*UP*AP*CP*C)-3') A 66.7
/43.9
30
/30
D9N195_CHICK Melanoma differentiation associated protein-5
5jcf[1] C RNA (5'-R(P*AP*GP*GP*UP*AP*CP*GP*UP*AP*CP*C)-3') A 69.0
/44.5
29
/29
D9N195_CHICK Melanoma differentiation associated protein-5
7niq[1] B RNA (5'-R(P*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP*GP*AP.. A 61.1
/44.2
18
/18
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7niq[1] C RNA (5'-R(P*AP*UP*CP*UP*CP*CP*UP*CP*GP*GP*CP*UP*UP.. A 68.2
/44.2
22
/22
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6g1s[1] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 40.0
/44.7
15
/15
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6g1x[1] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 36.4
/45.4
11
/11
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6h61[3] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 53.3
/44.7
15
/15
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7bkq[2] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 58.3
/44.0
12
/12
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
7bkq[1] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 0.0
/44.0
2
/2
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
7bkq[1] B RNA (5'-R(P*UP*CP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP*AP.. A 0.0
/44.0
2
/2
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
6g1s[1] C RNA (5'-R(P*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP.. A 73.1
/44.7
26
/26
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6g1x[3] C RNA (5'-R(P*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP.. A 72.0
/45.4
25
/25
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6h61[3] C RNA (5'-R(P*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP.. A 74.1
/44.7
27
/27
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7bkq[1] C RNA (5'-R(P*CP*GP*UP*CP*AP*UP*GP*CP*GP*CP*AP*UP*GP.. A 0.0
/44.0
1
/1
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
6gkh[1] B RNA (5'-R(P*GP*UP*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP.. A 60.0
/44.3
15
/15
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7nic[1] B RNA (5'-R(P*GP*UP*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP.. A 42.1
/44.0
19
/19
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gkh[2] C RNA (5'-R(P*UP*CP*UP*CP*CP*UP*CP*GP*GP*CP*UP*UP*GP.. A 57.7
/44.3
26
/26
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6g19[1] B RNA (5'-R(P*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP*GP*AP.. A 47.6
/43.9
21
/21
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gjz[2] B RNA (5'-R(P*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP*GP*AP.. A 47.6
/43.9
21
/21
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7bkp[1] C RNA (5'-R(P*CP*AP*AP*GP*CP*CP*GP*AP*GP*GP*AP*GP*AP.. A 50.0
/43.2
20
/20
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6g19[1] C RNA (5'-R(P*CP*UP*CP*UP*CP*CP*UP*CP*GP*GP*CP*UP*UP.. A 65.5
/43.9
29
/29
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gjz[3] C RNA (5'-R(P*CP*UP*CP*UP*CP*CP*UP*CP*GP*GP*CP*UP*UP.. A 66.7
/43.9
30
/30
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7eld[1] B pri-miRNA 166f A 31.2
/38.0
32
/74
DCL1_ARATH Endoribonuclease Dicer homolog 1
7ele[1] B pre-miRNA 166f A 32.1
/38.0
28
/63
DCL1_ARATH Endoribonuclease Dicer homolog 1
5zal[1] C RNA (73-mer) A 20.0
/37.9
5
/31
DICER_HUMAN Endoribonuclease Dicer
5zam[1] C RNA (73-mer) A 50.0
/37.9
2
/27
DICER_HUMAN Endoribonuclease Dicer
6p4f[2] E DNA (5'-D(*TP*TP*GP*AP*CP*TP*CP*AP*AP*CP*AP*TP*CP*.. A 23.1
/37.7
13
/18
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4f[1] F DNA (5'-D(P*TP*GP*TP*AP*GP*GP*TP*TP*TP*CP*CP*AP*TP.. A 15.8
/37.7
19
/21
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4f[1] H DNA (5'-D(P*TP*GP*TP*AP*GP*GP*TP*TP*TP*CP*CP*AP*TP.. C 22.2
/37.7
18
/19
Q970I2_SULTO DNA-dependent ATPase XPBII
4a36[1] E 5'-R(*GP*CP*AP*UP*GP*CP*GP*AP*CP*CP*UP*CP*UP*GP *U.. B 14.3
/36.2
7
/7
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a36[1] F 5'-R(*UP*CP*AP*AP*AP*CP*AP*GP*AP*GP*GP*UP*CP*GP *C.. B 54.2
/36.2
24
/25
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a36[1] C 5'-R(*GP*CP*AP*UP*GP*CP*GP*AP*CP*CP*UP*CP*UP*GP *U.. A 14.3
/36.2
7
/7
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a36[1] D 5'-R(*UP*CP*AP*AP*AP*CP*AP*GP*AP*GP*GP*UP*CP*GP *C.. A 52.2
/36.2
23
/24
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
5e3h[1] B RNA (5'-R(*CP*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*U)-3').. A 55.6
/35.6
18
/18
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5e3h[1] C RNA (5'-R(*CP*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*U)-3').. A 59.3
/35.6
27
/27
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4d25[2] B 5'-R(*UP*GP*AP*CP*AP*UP)-3' A 33.3
/35.6
9
/24
O01378_BOMMO BMVLG PROTEIN
7jl3[3] G dsRNA strand1 A 50.0
/35.6
14
/14
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7jl3[3] H dsRNA strand 2 A 62.5
/35.6
24
/24
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7jl0[1] A RNA (5'-R(P*GP*AP*CP*UP*GP*AP*CP*UP*GP*AP*CP*UP*GP.. C 63.6
/44.9
11
/11
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl1[1] B dsRNA strand 1 A 47.1
/35.6
17
/17
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7jl0[1] B RNA (5'-R(P*UP*CP*AP*GP*UP*CP*AP*GP*UP*CP*AP*GP*UP.. C 61.9
/44.9
21
/21
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl1[1] C dsRNA strand 2 A 59.3
/35.6
27
/27
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
6bu9[1] B RNA (5'-R(*GP*GP*AP*GP*GP*UP*AP*GP*UP*AP*GP*GP*UP*.. A 100.0
/35.4
1
/1
A1ZAW0_DROME Dicer-2, isoform A
5f9h[6] B RNA (5'-R(P*AP*AP*UP*AP*UP*AP*AP*UP*AP*GP*UP*GP*AP.. A 55.6
/35.3
36
/37
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
6kyv[6] A RNA (5'-R(*GP*GP*UP*AP*GP*AP*CP*GP*CP*UP*UP*CP*GP*.. B 55.6
/35.3
45
/46
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
7to2[1] B p3SLR30 A 45.6
/35.1
57
/57
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
6gpg[1] A RNA (5'-R(*CP*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*CP*.. C 52.6
/35.1
19
/19
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
6gpg[1] B RNA (5'-R(*CP*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*CP*.. C 58.6
/35.1
29
/29
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[12] B RNA (5'-R(P*GP*AP*AP*UP*AP*UP*AP*AP*UP*AP*GP*UP*GP.. A 59.0
/35.1
39
/40
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
7tny[2] B p2dsRNA A 38.5
/34.8
26
/26
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7tny[2] C p2dsRNA A 58.6
/34.8
29
/29
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8dvu[1] B OHSLR30 A 47.3
/35.0
55
/55
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7to0[1] B OHdsRNA A 42.3
/35.0
26
/27
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7to0[1] C OHdsRNA A 60.7
/35.0
28
/28
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8dvs[1] B OHSLR30 A 47.9
/35.0
48
/48
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7tnx[1] B p3dsRNAa A 43.5
/34.7
23
/24
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7tnx[1] C p3dsRNAb A 61.9
/34.7
21
/21
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
4ay2[1] B 5'-R-PPP(GP*GP*CP*GP*CP*GP*GP*CP*UP*UP*CP*GP*GP*CP.. A 38.7
/34.6
31
/31
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
2ykg[4] B 5'-R(*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP)-3' A 43.8
/34.5
16
/16
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
2ykg[4] C 5'-R(*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP)-3' A 37.5
/34.5
16
/16
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
7to1[1] B p3SLR30 A 52.5
/34.3
40
/41
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8dvr[1] B p3SLR30 A 54.5
/34.3
33
/33
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7v[2] E p3dsRNA24a A 47.6
/34.7
21
/21
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7v[2] F p3dsRNA24b A 57.9
/34.7
19
/19
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[2] E p3dsRNA24a A 38.1
/34.7
21
/22
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[2] E p3dsRNA24a C 57.1
/33.9
21
/21
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[2] F p3dsRNA24b A 54.2
/34.7
24
/24
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[2] F p3dsRNA24b C 43.8
/33.9
16
/16
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
4a2x[2] E 5'-R(*GP*GP*GP*AP*GP*AP*AP*CP*AP*AP*CP*GP*CP*GP)-3.. A 44.4
/32.4
9
/9
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a2x[2] E 5'-R(*GP*GP*GP*AP*GP*AP*AP*CP*AP*AP*CP*GP*CP*GP)-3.. B 0.0
/32.4
1
/1
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a2x[2] F 5'-R(*CP*GP*CP*GP*UP*UP*GP*UP*UP*CP*UP*CP*CP*CP)-3.. A 0.0
/32.4
2
/2
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a2x[2] F 5'-R(*CP*GP*CP*GP*UP*UP*GP*UP*UP*CP*UP*CP*CP*CP)-3.. B 44.4
/32.4
9
/9
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
3lrn[2] C RNA (5'-R(*(GTP)P*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*GP.. A 46.7
/31.2
15
/15
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3lrn[2] D RNA (5'-R(*(GTP)P*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*GP.. A 33.3
/31.2
3
/3
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3lrr[2] C RNA (5'-R(*(ATP)P*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*U).. A 46.7
/31.2
15
/15
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3lrr[2] D RNA (5'-R(*(ATP)P*UP*AP*UP*AP*UP*AP*UP*AP*UP*AP*U).. A 50.0
/31.2
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3ncu[2] C 5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3' A 61.5
/31.2
13
/13
DDX58_HUMAN RIG-I
3ncu[2] D 5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3' A 50.0
/31.2
4
/4
DDX58_HUMAN RIG-I
7bai[4] C RNA (5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C).. A 72.7
/31.2
11
/11
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7bai[4] D RNA (5'-R(*(GDP)P*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C).. A 66.7
/31.2
3
/3
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7bah[2] C RNA (5'-R(*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3').. A 63.6
/31.2
11
/11
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7bah[2] D RNA (5'-R(*GP*AP*CP*GP*CP*UP*AP*GP*CP*GP*UP*C)-3').. A 66.7
/31.2
3
/3
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7mk1[2] C DNA (41-MER) A 35.3
/31.2
17
/17
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7v6c[1] C RNA (5'-R(P*UP*GP*AP*GP*G)-3') A 0.0
/31.2
3
/5
A1ZAW0_DROME Dicer-2, isoform A
7v6c[1] D RNA (5'-R(P*CP*CP*UP*CP*UP*CP*U)-3') A 57.1
/31.2
7
/8
A1ZAW0_DROME Dicer-2, isoform A
3og8[2] C RNA (5'-R(*GP*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*.. A 63.6
/31.0
11
/11
DDX58_HUMAN ATP-dependent RNA helicase DDX58
3og8[2] D RNA (5'-R(*GP*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*.. A 50.0
/31.0
4
/4
DDX58_HUMAN ATP-dependent RNA helicase DDX58
7w0a[2] C RNA (30-MER) A 0.0
/31.0
5
/17
A1ZAW0_DROME Dicer-2, isoform A
7w0a[2] D RNA (32-MER) A 47.1
/31.0
17
/29
A1ZAW0_DROME Dicer-2, isoform A
7w0c[1] C RNA (35-MER) A 0.0
/31.0
6
/20
A1ZAW0_DROME Dicer-2, isoform A
7w0c[1] D RNA (35-MER) A 50.0
/31.0
18
/29
A1ZAW0_DROME Dicer-2, isoform A
7w0d[2] B dsRNA D 47.1
/31.0
17
/37
A1ZAW0_DROME Dicer-2, isoform A
7w0d[2] F dsRNA D 0.0
/31.0
5
/22
A1ZAW0_DROME Dicer-2, isoform A
7w0e[1] A dsRNA C 0.0
/31.0
7
/38
A1ZAW0_DROME Dicer-2, isoform A
7w0e[1] B dsRNA C 43.8
/31.0
16
/61
A1ZAW0_DROME Dicer-2, isoform A
7w0f[1] E siRNA A 0.0
/31.0
8
/19
A1ZAW0_DROME Dicer-2, isoform A
7w0f[1] F siRNA A 46.7
/31.0
15
/32
A1ZAW0_DROME Dicer-2, isoform A
8hf0[2] F RNA (52-MER) A 0.0
/31.0
7
/15
A1ZAW0_DROME Dicer-2, isoform A
8hf0[2] G RNA (52-MER) A 47.1
/31.0
17
/24
A1ZAW0_DROME Dicer-2, isoform A
8hf1[3] E RNA (5'-R(P*GP*AP*GP*AP*CP*UP*UP*GP*G)-3') A 0.0
/31.0
6
/13
A1ZAW0_DROME Dicer-2, isoform A
8hf1[3] H RNA (5'-R(P*CP*CP*AP*AP*GP*UP*CP*UP*CP*UP*U)-3') A 60.0
/31.0
15
/23
A1ZAW0_DROME Dicer-2, isoform A
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
678 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3tbk[4] B ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 77.8
/34.9
9
/12
DDX58_MOUSE RIG-I Helicase Domain
4d25[1] C ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 100.0
/35.6
2
/22
O01378_BOMMO BMVLG PROTEIN
6gjz[1] E ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 80.0
/43.9
10
/10
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gkm[2] E ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
A 80.0
/43.3
10
/10
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
5f98[6] O M7G
7N-METHYL-8-HYDROGUANOSINE-5'-DIPHOSPHATE[29 atoms..
A 28.6
/35.1
7
/7
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3zd7[22] F ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 77.8
/34.9
9
/14
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
4d26[1] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/35.6
1
/19
O01378_BOMMO BMVLG PROTEIN
6gkh[4] D ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 84.6
/44.3
13
/13
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7jl0[4] F ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
C 81.8
/44.9
11
/11
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl1[4] E ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 87.5
/35.6
8
/10
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7to2[3] E ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 80.0
/35.1
10
/12
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
5f9h[6] Q GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 44.4
/35.3
9
/10
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
8dvr[1] D GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 50.0
/34.3
10
/10
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
678 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2qfd[10] K HG
MERCURY (II) ION[1 atoms]
A 100.0
/31.2
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
2w4r[4] E HG
MERCURY (II) ION[1 atoms]
A 100.0
/100.0
4
/4
DHX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DHX58
3b6e[1] B NA
SODIUM ION[1 atoms]
A 100.0
/54.2
5
/5
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
3eaq[1] C CL
CHLORIDE ION[1 atoms]
A 0.0
/37.1
2
/3
Q72GF3_THET2 Heat resistant RNA dependent ATPase
3eaq[1] D CL
CHLORIDE ION[1 atoms]
B 0.0
/37.1
3
/3
Q72GF3_THET2 Heat resistant RNA dependent ATPase
4on9[1] G CL
CHLORIDE ION[1 atoms]
B 50.0
/35.2
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5tnu[1] J CL
CHLORIDE ION[1 atoms]
A 0.0
/38.0
2
/2
Q970I2_SULTO DNA-dependent ATPase XPBII
5tnu[1] K CL
CHLORIDE ION[1 atoms]
A 0.0
/38.0
3
/3
Q970I2_SULTO DNA-dependent ATPase XPBII
5tnu[4] M CL
CHLORIDE ION[1 atoms]
A 0.0
/38.0
1
/2
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4f[1] Q CL
CHLORIDE ION[1 atoms]
A 100.0
/37.7
1
/1
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4o[1] I CL
CHLORIDE ION[1 atoms]
A 100.0
/37.7
1
/1
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4w[2] I CL
CHLORIDE ION[1 atoms]
A 25.0
/37.7
4
/4
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4w[2] J CL
CHLORIDE ION[1 atoms]
A 0.0
/37.7
1
/1
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4w[1] L CL
CHLORIDE ION[1 atoms]
A 50.0
/37.7
2
/2
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4w[1] BA CL
CHLORIDE ION[1 atoms]
C 100.0
/37.7
1
/1
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4w[1] Z CL
CHLORIDE ION[1 atoms]
C 100.0
/37.7
1
/2
Q970I2_SULTO DNA-dependent ATPase XPBII
3zd7[1] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/34.9
2
/2
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
4a36[13] H MG
MAGNESIUM ION[1 atoms]
A 80.0
/36.2
5
/5
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4ay2[1] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/34.6
3
/3
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
5e3h[5] E MG
MAGNESIUM ION[1 atoms]
A 0.0
/35.6
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5e3h[1] F MG
MAGNESIUM ION[1 atoms]
A 100.0
/35.6
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5e3h[2] G MG
MAGNESIUM ION[1 atoms]
A 50.0
/35.6
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[6] N MG
MAGNESIUM ION[1 atoms]
A 50.0
/35.1
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[4] N MG
MAGNESIUM ION[1 atoms]
A 0.0
/35.1
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[2] N MG
MAGNESIUM ION[1 atoms]
A 0.0
/35.3
2
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[1] O MG
MAGNESIUM ION[1 atoms]
A 0.0
/35.3
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[1] P MG
MAGNESIUM ION[1 atoms]
A 100.0
/35.3
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[1] U MG
MAGNESIUM ION[1 atoms]
E 0.0
/35.6
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9h[1] X MG
MAGNESIUM ION[1 atoms]
G 50.0
/35.0
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5jaj[1] G MG
MAGNESIUM ION[1 atoms]
A 100.0
/53.9
2
/2
G0YYQ5_CHICK LGP2
5jb2[2] G MG
MAGNESIUM ION[1 atoms]
A 100.0
/53.2
2
/2
G0YYQ5_CHICK LGP2
5jb2[1] H MG
MAGNESIUM ION[1 atoms]
A 0.0
/53.2
1
/1
G0YYQ5_CHICK LGP2
6gkh[1] F MG
MAGNESIUM ION[1 atoms]
A 100.0
/44.3
1
/1
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gpg[4] E MG
MAGNESIUM ION[1 atoms]
C 50.0
/35.1
2
/2
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
6p4f[1] I MG
MAGNESIUM ION[1 atoms]
A 0.0
/37.7
1
/1
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4f[2] N MG
MAGNESIUM ION[1 atoms]
A 40.0
/37.7
5
/5
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4f[1] HA MG
MAGNESIUM ION[1 atoms]
C 25.0
/37.7
4
/4
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4w[2] F MG
MAGNESIUM ION[1 atoms]
A 100.0
/37.7
3
/3
Q970I2_SULTO DNA-dependent ATPase XPBII
7bkp[1] F MG
MAGNESIUM ION[1 atoms]
A 100.0
/43.2
1
/1
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7jl0[1] H MG
MAGNESIUM ION[1 atoms]
C 100.0
/44.9
1
/1
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7mk1[2] F MG
MAGNESIUM ION[1 atoms]
A 0.0
/31.2
1
/1
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7to2[3] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/35.1
2
/2
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
2qfb[10] K ZN
ZINC ION[1 atoms]
A 100.0
/31.2
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
2rqa[12] B ZN
ZINC ION[1 atoms]
A 100.0
/100.0
6
/6
DHX58_HUMAN ATP-dependent RNA helicase DHX58
2rqb[3] B ZN
ZINC ION[1 atoms]
A 100.0
/34.8
5
/5
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
2ykg[3] D ZN
ZINC ION[1 atoms]
A 100.0
/34.5
4
/4
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
3lrn[4] E ZN
ZINC ION[1 atoms]
A 100.0
/31.2
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3ncu[2] E ZN
ZINC ION[1 atoms]
A 100.0
/31.2
4
/4
DDX58_HUMAN RIG-I
3og8[9] E ZN
ZINC ION[1 atoms]
A 100.0
/31.0
4
/4
DDX58_HUMAN ATP-dependent RNA helicase DDX58
4ay2[7] C ZN
ZINC ION[1 atoms]
A 100.0
/34.6
4
/4
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
4bpb[23] D ZN
ZINC ION[1 atoms]
A 100.0
/34.3
4
/4
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
4gl2[10] H ZN
ZINC ION[1 atoms]
A 100.0
/47.2
5
/5
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
5jaj[1] D ZN
ZINC ION[1 atoms]
A 100.0
/53.9
4
/4
G0YYQ5_CHICK LGP2
5jb2[3] D ZN
ZINC ION[1 atoms]
A 100.0
/53.2
4
/4
G0YYQ5_CHICK LGP2
6gjz[5] D ZN
ZINC ION[1 atoms]
A 100.0
/43.9
4
/4
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
6gpg[1] D ZN
ZINC ION[1 atoms]
C 100.0
/35.1
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
7bkp[4] D ZN
ZINC ION[1 atoms]
A 100.0
/43.2
5
/5
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7bkq[2] D ZN
ZINC ION[1 atoms]
A 80.0
/44.0
5
/5
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
7jl0[4] E ZN
ZINC ION[1 atoms]
C 100.0
/44.9
4
/4
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl1[4] H ZN
ZINC ION[1 atoms]
A 75.0
/35.6
4
/4
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7tnx[15] D ZN
ZINC ION[1 atoms]
A 100.0
/34.7
4
/4
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
678 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3eqt[2] B DHX58_HUMAN ATP-dependent RNA helicase DHX58[142 aa] A 100.0
/100.0
2
/2
DHX58_HUMAN ATP-dependent RNA helicase DHX58
5jc7[2] B D9N195_CHICK Melanoma differentiation associated protein-5[647 .. A 9.5
/45.3
21
/21
D9N195_CHICK Melanoma differentiation associated protein-5
7jl2[2] E IFIH1_HUMAN Interferon-induced helicase C domain-containing pr.. C 11.1
/44.9
9
/9
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl2[2] G IFIH1_HUMAN Interferon-induced helicase C domain-containing pr.. C 0.0
/44.9
8
/9
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7bkq[1] A IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-.. A 30.0
/44.0
10
/11
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
7bkq[1] A IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-.. A 25.0
/44.0
12
/13
IFIH1_MOUSE Isoform 2 of Interferon-induced helicase C domain-..
4on9[2] B DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[495 aa] A 35.1
/36.3
37
/40
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[18] C DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[648 aa] A 11.1
/35.1
18
/20
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[6] E DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[641 aa] A 3.8
/35.1
26
/26
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[6] G DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[647 aa] A 0.0
/35.1
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[6] K DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[644 aa] A 0.0
/35.1
1
/3
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[6] G DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[647 aa] C 45.5
/35.2
11
/11
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f98[5] K DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[644 aa] C 0.0
/35.2
1
/3
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
7jl3[2] C DDX58_HUMAN Antiviral innate immune response receptor RIG-I[65.. A 0.0
/35.6
7
/7
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
7jl3[2] E DDX58_HUMAN Antiviral innate immune response receptor RIG-I[65.. A 16.7
/35.6
6
/6
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7t[4] C DDX58_HUMAN Antiviral innate immune response receptor RIG-I[61.. A 25.0
/34.7
8
/10
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7u[1] A DDX58_HUMAN Antiviral innate immune response receptor RIG-I[64.. C 22.2
/34.1
9
/10
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
8g7v[1] A DDX58_HUMAN Antiviral innate immune response receptor RIG-I[64.. C 0.0
/34.3
7
/9
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
4w7s[1] B PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28.. A 0.0
/31.6
1
/20
PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28..
7w0a[2] H A1ZAW0_DROME Dicer-2, isoform A[1478 aa] A 31.8
/31.0
22
/55
A1ZAW0_DROME Dicer-2, isoform A
8hf0[1] D A1ZAW0_DROME Dicer-2, isoform A[1561 aa] A 0.0
/31.0
1
/11
A1ZAW0_DROME Dicer-2, isoform A
8hf0[1] A A1ZAW0_DROME Dicer-2, isoform A[1561 aa] D 33.3
/31.0
3
/13
A1ZAW0_DROME Dicer-2, isoform A
8hf1[2] D A1ZAW0_DROME Dicer-2, isoform A[1561 aa] A 37.5
/31.0
8
/28
A1ZAW0_DROME Dicer-2, isoform A
8hf1[2] A A1ZAW0_DROME Dicer-2, isoform A[1561 aa] D 33.3
/31.0
3
/31
A1ZAW0_DROME Dicer-2, isoform A
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
678 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3tbk[1] C EDO
1,2-ETHANEDIOL[4 atoms]
A 28.6
/34.9
7
/7
DDX58_MOUSE RIG-I Helicase Domain
5jaj[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 80.0
/53.9
5
/5
G0YYQ5_CHICK LGP2
5jaj[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 40.0
/53.9
5
/5
G0YYQ5_CHICK LGP2
5jaj[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/53.9
6
/6
G0YYQ5_CHICK LGP2
5jaj[1] K MGF
TRIFLUOROMAGNESATE[4 atoms]
A 0.0
/53.9
1
/1
G0YYQ5_CHICK LGP2
5jaj[1] F ALF
TETRAFLUOROALUMINATE ION[5 atoms]
A 100.0
/53.9
8
/8
G0YYQ5_CHICK LGP2
5jb2[2] F ALF
TETRAFLUOROALUMINATE ION[5 atoms]
A 100.0
/53.2
8
/8
G0YYQ5_CHICK LGP2
6gkh[3] E ALF
TETRAFLUOROALUMINATE ION[5 atoms]
A 100.0
/44.3
6
/6
IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
7jl0[4] G ALF
TETRAFLUOROALUMINATE ION[5 atoms]
C 100.0
/44.9
6
/6
IFIH1_HUMAN Interferon-induced helicase C domain-containing pr..
7jl1[4] F ALF
TETRAFLUOROALUMINATE ION[5 atoms]
A 100.0
/35.6
5
/5
DDX58_HUMAN Antiviral innate immune response receptor RIG-I
2w4r[4] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
DHX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DHX58
2w4r[1] K SO4
SULFATE ION[5 atoms]
C 100.0
/100.0
4
/4
DHX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DHX58
2ykg[3] E SO4
SULFATE ION[5 atoms]
A 85.7
/34.5
7
/7
DDX58_HUMAN PROBABLE ATP-DEPENDENT RNA HELICASE DDX58
3ts9[1] B SO4
SULFATE ION[5 atoms]
A 100.0
/41.8
1
/1
IFIH1_MOUSE IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
3ts9[4] D SO4
SULFATE ION[5 atoms]
A 50.0
/41.8
4
/4
IFIH1_MOUSE IFIH1_MOUSE Interferon-induced helicase C domain-containing pr..
4kbg[1] E SO4
SULFATE ION[5 atoms]
B 0.0
/37.1
1
/8
Q72GF3_THET2 Heat resistant RNA dependent ATPase
4kbg[1] H SO4
SULFATE ION[5 atoms]
B 20.0
/37.1
5
/5
Q72GF3_THET2 Heat resistant RNA dependent ATPase
4on9[2] D SO4
SULFATE ION[5 atoms]
A 50.0
/36.3
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
4on9[2] E SO4
SULFATE ION[5 atoms]
A 0.0
/36.3
1
/1
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5jbg[1] G SO4
SULFATE ION[5 atoms]
A 33.3
/53.4
3
/3
G0YYQ5_CHICK LGP2
5jbg[1] H SO4
SULFATE ION[5 atoms]
A 66.7
/53.4
3
/3
G0YYQ5_CHICK LGP2
5jbg[1] I SO4
SULFATE ION[5 atoms]
A 0.0
/53.4
1
/1
G0YYQ5_CHICK LGP2
5jbg[1] J SO4
SULFATE ION[5 atoms]
A 0.0
/53.4
4
/4
G0YYQ5_CHICK LGP2
5tnu[4] C SO4
SULFATE ION[5 atoms]
A 100.0
/38.0
6
/6
Q970I2_SULTO DNA-dependent ATPase XPBII
5tnu[1] E SO4
SULFATE ION[5 atoms]
A 100.0
/38.0
1
/1
Q970I2_SULTO DNA-dependent ATPase XPBII
5tnu[2] F SO4
SULFATE ION[5 atoms]
A 100.0
/38.0
1
/3
Q970I2_SULTO DNA-dependent ATPase XPBII
5tnu[2] G SO4
SULFATE ION[5 atoms]
A 25.0
/38.0
4
/4
Q970I2_SULTO DNA-dependent ATPase XPBII
5tnu[1] H SO4
SULFATE ION[5 atoms]
A 0.0
/38.0
2
/6
Q970I2_SULTO DNA-dependent ATPase XPBII
5tnu[1] Y SO4
SULFATE ION[5 atoms]
B 100.0
/38.1
1
/3
Q970I2_SULTO DNA-dependent ATPase XPBII
1wp9[6] G PO4
PHOSPHATE ION[5 atoms]
A 85.7
/31.2
7
/7
Q8TZH8_PYRFU ATP-dependent RNA helicase, putative
4d26[1] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/35.6
1
/9
O01378_BOMMO BMVLG PROTEIN
6p4w[2] E PO4
PHOSPHATE ION[5 atoms]
A 80.0
/37.7
5
/5
Q970I2_SULTO DNA-dependent ATPase XPBII
4a2v[3] C GOL
GLYCEROL[6 atoms]
A 33.3
/32.4
6
/8
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4a2v[1] D GOL
GLYCEROL[6 atoms]
A 66.7
/32.4
3
/3
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
4d25[1] E GOL
GLYCEROL[6 atoms]
A 0.0
/35.6
2
/3
O01378_BOMMO BMVLG PROTEIN
5e3h[1] H GOL
GLYCEROL[6 atoms]
A 100.0
/35.6
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5tnu[1] S GOL
GLYCEROL[6 atoms]
A 25.0
/38.0
4
/4
Q970I2_SULTO DNA-dependent ATPase XPBII
5tnu[1] T GOL
GLYCEROL[6 atoms]
A 0.0
/38.0
1
/3
Q970I2_SULTO DNA-dependent ATPase XPBII
5tnu[1] BA GOL
GLYCEROL[6 atoms]
B 33.3
/38.1
3
/4
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4o[2] G GOL
GLYCEROL[6 atoms]
A 100.0
/37.7
1
/1
Q970I2_SULTO DNA-dependent ATPase XPBII
6p4o[1] L GOL
GLYCEROL[6 atoms]
E 100.0
/38.0
1
/1
Q970I2_SULTO DNA-dependent ATPase XPBII
4a36[2] I AF3
ALUMINUM FLUORIDE[4 atoms]
A 100.0
/36.2
9
/9
D3TI84_ANAPL RETINOIC ACID INDUCIBLE PROTEIN I
5e3h[1] J BEF
BERYLLIUM TRIFLUORIDE ION[4 atoms]
A 100.0
/35.6
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] O ETF
TRIFLUOROETHANOL[6 atoms]
A 66.7
/35.1
9
/9
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] Y ETF
TRIFLUOROETHANOL[6 atoms]
E 40.0
/35.0
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[2] CA ETF
TRIFLUOROETHANOL[6 atoms]
G 0.0
/35.2
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] NA ETF
TRIFLUOROETHANOL[6 atoms]
K 66.7
/35.1
6
/6
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] P BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
A 71.4
/35.1
7
/7
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] Q BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
A 80.0
/35.1
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[2] U BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
A 0.0
/35.1
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] T BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
C 25.0
/35.1
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] V BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
C 25.0
/35.1
4
/4
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[5] W BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
C 62.5
/35.1
8
/8
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[2] AA BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
E 44.4
/35.0
9
/9
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
5f9f[1] EA BU3
(R,R)-2,3-BUTANEDIOL[6 atoms]
G 0.0
/35.2
5
/5
DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.