HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

890320

503

Q92985(IRF7_HUMAN)

RecName: Full=Interferon regulatory factor 7; Short=IRF-7;

QUERYSEQ

MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP
QGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVL
VKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q92985(IRF7_HUMAN)]

503
	region	name	description
	1-503	CHAIN	/note="Interferon regulatory factor 7" /id="PRO_0000154562"
	11-126	DNA_BIND	/note="IRF tryptophan pentad repeat"
	69-88	REGION	/note="Disordered"
	133-156	REGION	/note="Disordered"
	242-277	REGION	/note="Disordered"
	284-456	REGION	/note="Necessary for the interaction with NMI"
	1-503	DISORDER	predicted by DISOPRED

MONOMER

503

pdb_id a¹ identity[%]² description

2o61 C 99.1 TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory factor 7/Interferon regulatory factor 3 fusion protein

3dsh A 33.3 IRF5_HUMAN Interferon regulatory factor 5

1qwt B 30.8 IRF3_HUMAN Interferon regulatory factor 3

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

503 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2o61[1] D NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit[314 aa] C 100.0
/99.1 3
/19 TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..

1t2k[1] F ATF2_HUMAN Cyclic-AMP-dependent transcription factor ATF-2[61.. C 66.7
/45.2 3
/3 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] B STING_HUMAN Stimulator of interferon genes protein[10 aa] D 46.7
/30.8 15
/15 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] C STING_HUMAN Stimulator of interferon genes protein[4 aa] D 50.0
/30.8 2
/2 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] C STING_HUMAN Stimulator of interferon genes protein[4 aa] E 40.0
/30.8 5
/5 IRF3_HUMAN Interferon regulatory factor 3

5jej[1] A STING_HUMAN Stimulator of interferon genes protein[21 aa] E 46.7
/30.8 15
/15 IRF3_HUMAN Interferon regulatory factor 3

5jek[1] C MAVS peptide[14 aa] A 46.2
/30.8 13
/13 IRF3_HUMAN Interferon regulatory factor 3

5jek[1] D MAVS peptide[16 aa] B 41.7
/30.8 12
/12 IRF3_HUMAN Interferon regulatory factor 3

5jel[2] B Phosphorylated TRIF peptide[14 aa] A 31.2
/30.8 16
/16 IRF3_HUMAN Interferon regulatory factor 3

5jeo[2] A Rotavirus NSP1 peptide[10 aa] B 47.1
/30.8 17
/17 IRF3_HUMAN Interferon regulatory factor 3

5jer[4] A Rotavirus NSP1 peptide[10 aa] E 35.7
/30.8 14
/14 IRF3_HUMAN Interferon regulatory factor 3

5jer[1] D Rotavirus NSP1 peptide[10 aa] F 100.0
/30.8 1
/1 IRF3_HUMAN Interferon regulatory factor 3

1zoq[2] B CBP_HUMAN CREB-binding protein[47 aa] A 13.3
/31.3 15
/18 IRF3_HUMAN Interferon regulatory factor 3

5jem[7] B CBP_HUMAN CREB-binding protein[42 aa] A 20.0
/30.6 15
/18 IRF3_HUMAN Interferon regulatory factor 3

5jem[4] D CBP_HUMAN CREB-binding protein[42 aa] A 0.0
/30.6 2
/3 IRF3_HUMAN Interferon regulatory factor 3

7jfm[1] D CBP_HUMAN CREB-binding protein[37 aa] A 0.0
/31.6 1
/1 IRF3_MOUSE Interferon regulatory factor 3

7jfm[1] D CBP_HUMAN CREB-binding protein[37 aa] C 14.3
/30.7 14
/17 IRF3_MOUSE Interferon regulatory factor 3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

503 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2o61[1] A 36-MER C 100.0
/99.1 10
/34 TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..

2o61[1] B 34-MER C 93.8
/99.1 16
/36 TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..

7jm4[8] A Interferon-Stimulated Response Elements C 70.0
/46.0 10
/10 IRF4_HUMAN Interferon regulatory factor 4

7jm4[6] B Interferon-Stimulated Response Elements C 33.3
/46.0 6
/9 IRF4_HUMAN Interferon regulatory factor 4

7rh2[2] F DNA (5'-D(*GP*CP*TP*TP*TP*CP*TP*CP*GP*GP*TP*TP*TP*.. G 50.0
/47.0 8
/11 Q99419_HUMAN ICSAT transcription factor

2pi0[4] A PRDIII-I region of human interferon-B promoter str.. C 50.0
/46.9 12
/12 IRF3_HUMAN Interferon regulatory factor 3

2pi0[4] B PRDIII-I region of human interferon-B promoter str.. C 50.0
/46.9 12
/13 IRF3_HUMAN Interferon regulatory factor 3

7o56[3] B DNA (5'-D(P*AP*AP*TP*AP*AP*AP*AP*GP*AP*AP*AP*CP*CP.. A 66.7
/45.6 9
/9 IRF4_HUMAN Interferon regulatory factor 4

7o56[2] C DNA (5'-D(P*TP*TP*TP*AP*CP*TP*TP*TP*CP*GP*GP*TP*TP.. A 40.0
/45.6 10
/13 IRF4_HUMAN Interferon regulatory factor 4

7ogs[4] C DNA (5'-D(P*TP*GP*TP*AP*CP*TP*TP*TP*CP*GP*GP*TP*TP.. A 55.6
/45.6 9
/13 IRF4_HUMAN Interferon regulatory factor 4

7ogs[4] D DNA (5'-D(P*AP*TP*AP*AP*CP*TP*GP*AP*AP*AP*CP*CP*GP.. A 66.7
/45.6 12
/12 IRF4_HUMAN Interferon regulatory factor 4

7oot[2] C DNA (5'-D(P*TP*CP*AP*AP*CP*TP*GP*AP*AP*AP*CP*CP*GP.. A 63.6
/45.6 11
/11 IRF4_HUMAN Interferon regulatory factor 4

7oot[2] D DNA (5'-D(P*AP*GP*CP*TP*TP*TP*CP*TP*CP*GP*GP*TP*TP.. A 20.0
/45.6 10
/13 IRF4_HUMAN Interferon regulatory factor 4

1t2k[2] A 31-MER C 55.6
/45.2 9
/9 IRF3_HUMAN Interferon regulatory factor 3

1t2k[2] B 31-MER C 43.8
/45.2 16
/17 IRF3_HUMAN Interferon regulatory factor 3

2o6g[4] A interferon-b enhancer C 50.0
/45.2 12
/12 IRF3_HUMAN Interferon regulatory factor 3

2o6g[4] B interferon-b enhancer C 40.0
/45.2 15
/16 IRF3_HUMAN Interferon regulatory factor 3

1if1[2] A DNA (26-MER) C 65.0
/39.5 20
/22 IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)

1if1[1] B DNA (26-MER) C 100.0
/39.5 1
/2 IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)

2irf[4] F DNA (5'-D(*TP*TP*CP*AP*CP*TP*TP*TP*CP*AP*CP*(5IU)P.. G 50.0
/38.7 10
/10 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

2irf[3] A DNA (5'-D(P*AP*AP*GP*TP*GP*AP*AP*AP*GP*(5IU)P*GP*A.. H 60.0
/38.7 10
/11 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

2irf[2] E DNA (5'-D(*TP*TP*CP*AP*CP*TP*TP*TP*CP*AP*CP*(5IU)P.. I 50.0
/38.7 10
/10 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

503 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3qu6[4] H CL
CHLORIDE ION[1 atoms] A 75.0
/45.8 4
/4 Q7Z5G6_HUMAN IRF3 protein

3qu6[1] I CL
CHLORIDE ION[1 atoms] A 0.0
/45.8 1
/1 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] M CL
CHLORIDE ION[1 atoms] A 25.0
/45.8 4
/4 Q7Z5G6_HUMAN IRF3 protein

5bvi[2] C CL
CHLORIDE ION[1 atoms] A 16.7
/30.1 6
/6 Q5SUZ4_MOUSE Interferon regulatory factor 4

5bvi[1] D CL
CHLORIDE ION[1 atoms] A 16.7
/30.1 6
/6 Q5SUZ4_MOUSE Interferon regulatory factor 4

5bvi[1] E CL
CHLORIDE ION[1 atoms] A 0.0
/30.1 2
/2 Q5SUZ4_MOUSE Interferon regulatory factor 4

6td4[1] B CL
CHLORIDE ION[1 atoms] A 100.0
/45.9 1
/1 IRF4_HUMAN Interferon regulatory factor 4

3qu3[3] D NA
SODIUM ION[1 atoms] A 75.0
/74.6 4
/4 IRF7_MOUSE Interferon regulatory factor 7

3qu6[1] K NA
SODIUM ION[1 atoms] A 50.0
/45.8 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] L NA
SODIUM ION[1 atoms] A 40.0
/45.8 5
/5 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] D ZN
ZINC ION[1 atoms] A 0.0
/45.8 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[1] E ZN
ZINC ION[1 atoms] A 0.0
/45.8 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[2] F ZN
ZINC ION[1 atoms] A 50.0
/45.8 2
/2 Q7Z5G6_HUMAN IRF3 protein

3qu6[4] G ZN
ZINC ION[1 atoms] A 25.0
/45.8 4
/4 Q7Z5G6_HUMAN IRF3 protein

2irf[6] M K
POTASSIUM ION[1 atoms] G 0.0
/38.7 4
/4 IRF2_MOUSE INTERFERON REGULATORY FACTOR 2

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

503 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7o56[1] E IRF4_HUMAN Interferon regulatory factor 4[112 aa] D 100.0
/45.6 2
/2 IRF4_HUMAN Interferon regulatory factor 4

7o56[1] D IRF4_HUMAN Interferon regulatory factor 4[109 aa] E 50.0
/45.6 2
/2 IRF4_HUMAN Interferon regulatory factor 4

2o6g[3] E IRF3_HUMAN Interferon regulatory factor 3[110 aa] C 33.3
/45.2 3
/3 IRF3_HUMAN Interferon regulatory factor 3

2o6g[2] C IRF3_HUMAN Interferon regulatory factor 3[110 aa] E 0.0
/45.2 3
/3 IRF3_HUMAN Interferon regulatory factor 3

2pi0[1] C IRF3_HUMAN Interferon regulatory factor 3[98 aa] E 0.0
/45.2 1
/1 IRF3_HUMAN Interferon regulatory factor 3

3dsh[2] A IRF5_HUMAN Interferon regulatory factor 5[236 aa] A 36.0
/33.3 50
/62 IRF5_HUMAN Interferon regulatory factor 5

1qwt[5] B IRF3_HUMAN Interferon regulatory factor 3[239 aa] A 44.4
/30.8 9
/9 IRF3_HUMAN Interferon regulatory factor 3

1qwt[1] A IRF3_HUMAN Interferon regulatory factor 3[239 aa] B 20.0
/30.8 10
/10 IRF3_HUMAN Interferon regulatory factor 3

5jej[16] E IRF3_HUMAN Interferon regulatory factor 3[233 aa] D 31.6
/30.8 19
/20 IRF3_HUMAN Interferon regulatory factor 3

7jfm[2] C IRF3_MOUSE Interferon regulatory factor 3[194 aa] A 29.7
/31.6 37
/38 IRF3_MOUSE Interferon regulatory factor 3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

503 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3qu3[1] F EDO
1,2-ETHANEDIOL[4 atoms] B 0.0
/73.9 2
/2 IRF7_MOUSE Interferon regulatory factor 7

3qu3[2] G EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/73.9 3
/3 IRF7_MOUSE Interferon regulatory factor 7

3qu3[1] J EDO
1,2-ETHANEDIOL[4 atoms] C 66.7
/73.9 3
/5 IRF7_MOUSE Interferon regulatory factor 7

1qwt[2] C PO4
PHOSPHATE ION[5 atoms] A 0.0
/30.8 4
/4 IRF3_HUMAN Interferon regulatory factor 3

1qwt[2] D PO4
PHOSPHATE ION[5 atoms] A 0.0
/30.8 3
/6 IRF3_HUMAN Interferon regulatory factor 3

1qwt[2] E PO4
PHOSPHATE ION[5 atoms] A 0.0
/30.8 3
/3 IRF3_HUMAN Interferon regulatory factor 3

1qwt[1] I PO4
PHOSPHATE ION[5 atoms] B 33.3
/30.8 3
/4 IRF3_HUMAN Interferon regulatory factor 3

1qwt[1] J PO4
PHOSPHATE ION[5 atoms] B 25.0
/30.8 4
/4 IRF3_HUMAN Interferon regulatory factor 3

5jeo[4] C PO4
PHOSPHATE ION[5 atoms] B 75.0
/30.8 4
/4 IRF3_HUMAN Interferon regulatory factor 3

5jeo[4] D PO4
PHOSPHATE ION[5 atoms] B 33.3
/30.8 3
/3 IRF3_HUMAN Interferon regulatory factor 3

5jeo[2] E PO4
PHOSPHATE ION[5 atoms] B 0.0
/30.8 2
/2 IRF3_HUMAN Interferon regulatory factor 3

7oot[1] E PO4
PHOSPHATE ION[5 atoms] B 0.0
/45.6 2
/2 IRF4_HUMAN Interferon regulatory factor 4

3a77[2] E ACY
ACETIC ACID[4 atoms] A 60.0
/31.8 5
/5 IRF3_HUMAN Interferon regulatory factor 3

3a77[4] F MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] A 20.0
/31.8 5
/5 IRF3_HUMAN Interferon regulatory factor 3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
503
	pdb_id	a¹	identity[%]²	description
	2o61	C	99.1	TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory factor 7/Interferon regulatory factor 3 fusion protein
	3dsh	A	33.3	IRF5_HUMAN Interferon regulatory factor 5
	1qwt	B	30.8	IRF3_HUMAN Interferon regulatory factor 3
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
503	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	2o61[1]	D	NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit[314 aa]	C	100.0 /99.1	3 /19	TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..
	1t2k[1]	F	ATF2_HUMAN Cyclic-AMP-dependent transcription factor ATF-2[61..	C	66.7 /45.2	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	B	STING_HUMAN Stimulator of interferon genes protein[10 aa]	D	46.7 /30.8	15 /15	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	C	STING_HUMAN Stimulator of interferon genes protein[4 aa]	D	50.0 /30.8	2 /2	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	C	STING_HUMAN Stimulator of interferon genes protein[4 aa]	E	40.0 /30.8	5 /5	IRF3_HUMAN Interferon regulatory factor 3
	5jej[1]	A	STING_HUMAN Stimulator of interferon genes protein[21 aa]	E	46.7 /30.8	15 /15	IRF3_HUMAN Interferon regulatory factor 3
	5jek[1]	C	MAVS peptide[14 aa]	A	46.2 /30.8	13 /13	IRF3_HUMAN Interferon regulatory factor 3
	5jek[1]	D	MAVS peptide[16 aa]	B	41.7 /30.8	12 /12	IRF3_HUMAN Interferon regulatory factor 3
	5jel[2]	B	Phosphorylated TRIF peptide[14 aa]	A	31.2 /30.8	16 /16	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[2]	A	Rotavirus NSP1 peptide[10 aa]	B	47.1 /30.8	17 /17	IRF3_HUMAN Interferon regulatory factor 3
	5jer[4]	A	Rotavirus NSP1 peptide[10 aa]	E	35.7 /30.8	14 /14	IRF3_HUMAN Interferon regulatory factor 3
	5jer[1]	D	Rotavirus NSP1 peptide[10 aa]	F	100.0 /30.8	1 /1	IRF3_HUMAN Interferon regulatory factor 3
	1zoq[2]	B	CBP_HUMAN CREB-binding protein[47 aa]	A	13.3 /31.3	15 /18	IRF3_HUMAN Interferon regulatory factor 3
	5jem[7]	B	CBP_HUMAN CREB-binding protein[42 aa]	A	20.0 /30.6	15 /18	IRF3_HUMAN Interferon regulatory factor 3
	5jem[4]	D	CBP_HUMAN CREB-binding protein[42 aa]	A	0.0 /30.6	2 /3	IRF3_HUMAN Interferon regulatory factor 3
	7jfm[1]	D	CBP_HUMAN CREB-binding protein[37 aa]	A	0.0 /31.6	1 /1	IRF3_MOUSE Interferon regulatory factor 3
	7jfm[1]	D	CBP_HUMAN CREB-binding protein[37 aa]	C	14.3 /30.7	14 /17	IRF3_MOUSE Interferon regulatory factor 3
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
503	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	2o61[1]	A	36-MER	C	100.0 /99.1	10 /34	TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..
	2o61[1]	B	34-MER	C	93.8 /99.1	16 /36	TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac..
	7jm4[8]	A	Interferon-Stimulated Response Elements	C	70.0 /46.0	10 /10	IRF4_HUMAN Interferon regulatory factor 4
	7jm4[6]	B	Interferon-Stimulated Response Elements	C	33.3 /46.0	6 /9	IRF4_HUMAN Interferon regulatory factor 4
	7rh2[2]	F	DNA (5'-D(GPCPTPTPTPCPTPCPGPGPTPTPTP..	G	50.0 /47.0	8 /11	Q99419_HUMAN ICSAT transcription factor
	2pi0[4]	A	PRDIII-I region of human interferon-B promoter str..	C	50.0 /46.9	12 /12	IRF3_HUMAN Interferon regulatory factor 3
	2pi0[4]	B	PRDIII-I region of human interferon-B promoter str..	C	50.0 /46.9	12 /13	IRF3_HUMAN Interferon regulatory factor 3
	7o56[3]	B	DNA (5'-D(PAPAPTPAPAPAPAPGPAPAPAPCP*CP..	A	66.7 /45.6	9 /9	IRF4_HUMAN Interferon regulatory factor 4
	7o56[2]	C	DNA (5'-D(PTPTPTPAPCPTPTPTPCPGPGPTP*TP..	A	40.0 /45.6	10 /13	IRF4_HUMAN Interferon regulatory factor 4
	7ogs[4]	C	DNA (5'-D(PTPGPTPAPCPTPTPTPCPGPGPTP*TP..	A	55.6 /45.6	9 /13	IRF4_HUMAN Interferon regulatory factor 4
	7ogs[4]	D	DNA (5'-D(PAPTPAPAPCPTPGPAPAPAPCPCP*GP..	A	66.7 /45.6	12 /12	IRF4_HUMAN Interferon regulatory factor 4
	7oot[2]	C	DNA (5'-D(PTPCPAPAPCPTPGPAPAPAPCPCP*GP..	A	63.6 /45.6	11 /11	IRF4_HUMAN Interferon regulatory factor 4
	7oot[2]	D	DNA (5'-D(PAPGPCPTPTPTPCPTPCPGPGPTP*TP..	A	20.0 /45.6	10 /13	IRF4_HUMAN Interferon regulatory factor 4
	1t2k[2]	A	31-MER	C	55.6 /45.2	9 /9	IRF3_HUMAN Interferon regulatory factor 3
	1t2k[2]	B	31-MER	C	43.8 /45.2	16 /17	IRF3_HUMAN Interferon regulatory factor 3
	2o6g[4]	A	interferon-b enhancer	C	50.0 /45.2	12 /12	IRF3_HUMAN Interferon regulatory factor 3
	2o6g[4]	B	interferon-b enhancer	C	40.0 /45.2	15 /16	IRF3_HUMAN Interferon regulatory factor 3
	1if1[2]	A	DNA (26-MER)	C	65.0 /39.5	20 /22	IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)
	1if1[1]	B	DNA (26-MER)	C	100.0 /39.5	1 /2	IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1)
	2irf[4]	F	DNA (5'-D(TPTPCPAPCPTPTPTPCPAPCP(5IU)P..	G	50.0 /38.7	10 /10	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	2irf[3]	A	DNA (5'-D(PAPAPGPTPGPAPAPAPGP(5IU)PGPA..	H	60.0 /38.7	10 /11	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	2irf[2]	E	DNA (5'-D(TPTPCPAPCPTPTPTPCPAPCP(5IU)P..	I	50.0 /38.7	10 /10	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
503	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3qu6[4]	H	CL CHLORIDE ION[1 atoms]	A	75.0 /45.8	4 /4	Q7Z5G6_HUMAN IRF3 protein
	3qu6[1]	I	CL CHLORIDE ION[1 atoms]	A	0.0 /45.8	1 /1	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	M	CL CHLORIDE ION[1 atoms]	A	25.0 /45.8	4 /4	Q7Z5G6_HUMAN IRF3 protein
	5bvi[2]	C	CL CHLORIDE ION[1 atoms]	A	16.7 /30.1	6 /6	Q5SUZ4_MOUSE Interferon regulatory factor 4
	5bvi[1]	D	CL CHLORIDE ION[1 atoms]	A	16.7 /30.1	6 /6	Q5SUZ4_MOUSE Interferon regulatory factor 4
	5bvi[1]	E	CL CHLORIDE ION[1 atoms]	A	0.0 /30.1	2 /2	Q5SUZ4_MOUSE Interferon regulatory factor 4
	6td4[1]	B	CL CHLORIDE ION[1 atoms]	A	100.0 /45.9	1 /1	IRF4_HUMAN Interferon regulatory factor 4
	3qu3[3]	D	NA SODIUM ION[1 atoms]	A	75.0 /74.6	4 /4	IRF7_MOUSE Interferon regulatory factor 7
	3qu6[1]	K	NA SODIUM ION[1 atoms]	A	50.0 /45.8	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	L	NA SODIUM ION[1 atoms]	A	40.0 /45.8	5 /5	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	D	ZN ZINC ION[1 atoms]	A	0.0 /45.8	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[1]	E	ZN ZINC ION[1 atoms]	A	0.0 /45.8	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[2]	F	ZN ZINC ION[1 atoms]	A	50.0 /45.8	2 /2	Q7Z5G6_HUMAN IRF3 protein
	3qu6[4]	G	ZN ZINC ION[1 atoms]	A	25.0 /45.8	4 /4	Q7Z5G6_HUMAN IRF3 protein
	2irf[6]	M	K POTASSIUM ION[1 atoms]	G	0.0 /38.7	4 /4	IRF2_MOUSE INTERFERON REGULATORY FACTOR 2
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
503	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7o56[1]	E	IRF4_HUMAN Interferon regulatory factor 4[112 aa]	D	100.0 /45.6	2 /2	IRF4_HUMAN Interferon regulatory factor 4
	7o56[1]	D	IRF4_HUMAN Interferon regulatory factor 4[109 aa]	E	50.0 /45.6	2 /2	IRF4_HUMAN Interferon regulatory factor 4
	2o6g[3]	E	IRF3_HUMAN Interferon regulatory factor 3[110 aa]	C	33.3 /45.2	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	2o6g[2]	C	IRF3_HUMAN Interferon regulatory factor 3[110 aa]	E	0.0 /45.2	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	2pi0[1]	C	IRF3_HUMAN Interferon regulatory factor 3[98 aa]	E	0.0 /45.2	1 /1	IRF3_HUMAN Interferon regulatory factor 3
	3dsh[2]	A	IRF5_HUMAN Interferon regulatory factor 5[236 aa]	A	36.0 /33.3	50 /62	IRF5_HUMAN Interferon regulatory factor 5
	1qwt[5]	B	IRF3_HUMAN Interferon regulatory factor 3[239 aa]	A	44.4 /30.8	9 /9	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[1]	A	IRF3_HUMAN Interferon regulatory factor 3[239 aa]	B	20.0 /30.8	10 /10	IRF3_HUMAN Interferon regulatory factor 3
	5jej[16]	E	IRF3_HUMAN Interferon regulatory factor 3[233 aa]	D	31.6 /30.8	19 /20	IRF3_HUMAN Interferon regulatory factor 3
	7jfm[2]	C	IRF3_MOUSE Interferon regulatory factor 3[194 aa]	A	29.7 /31.6	37 /38	IRF3_MOUSE Interferon regulatory factor 3
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
503	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3qu3[1]	F	EDO 1,2-ETHANEDIOL[4 atoms]	B	0.0 /73.9	2 /2	IRF7_MOUSE Interferon regulatory factor 7
	3qu3[2]	G	EDO 1,2-ETHANEDIOL[4 atoms]	B	100.0 /73.9	3 /3	IRF7_MOUSE Interferon regulatory factor 7
	3qu3[1]	J	EDO 1,2-ETHANEDIOL[4 atoms]	C	66.7 /73.9	3 /5	IRF7_MOUSE Interferon regulatory factor 7
	1qwt[2]	C	PO4 PHOSPHATE ION[5 atoms]	A	0.0 /30.8	4 /4	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[2]	D	PO4 PHOSPHATE ION[5 atoms]	A	0.0 /30.8	3 /6	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[2]	E	PO4 PHOSPHATE ION[5 atoms]	A	0.0 /30.8	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[1]	I	PO4 PHOSPHATE ION[5 atoms]	B	33.3 /30.8	3 /4	IRF3_HUMAN Interferon regulatory factor 3
	1qwt[1]	J	PO4 PHOSPHATE ION[5 atoms]	B	25.0 /30.8	4 /4	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[4]	C	PO4 PHOSPHATE ION[5 atoms]	B	75.0 /30.8	4 /4	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[4]	D	PO4 PHOSPHATE ION[5 atoms]	B	33.3 /30.8	3 /3	IRF3_HUMAN Interferon regulatory factor 3
	5jeo[2]	E	PO4 PHOSPHATE ION[5 atoms]	B	0.0 /30.8	2 /2	IRF3_HUMAN Interferon regulatory factor 3
	7oot[1]	E	PO4 PHOSPHATE ION[5 atoms]	B	0.0 /45.6	2 /2	IRF4_HUMAN Interferon regulatory factor 4
	3a77[2]	E	ACY ACETIC ACID[4 atoms]	A	60.0 /31.8	5 /5	IRF3_HUMAN Interferon regulatory factor 3
	3a77[4]	F	MPD (4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]	A	20.0 /31.8	5 /5	IRF3_HUMAN Interferon regulatory factor 3
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [Q92985(IRF7_HUMAN)]