Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3216056 503 101 Q92985(IRF7_HUMAN) RecName: Full=Interferon regulatory factor 7; Short=IRF-7;
QUERYSEQ
MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP
QGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVL
VKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q92985(IRF7_HUMAN)]

503
region name description
1-503 CHAIN /note="Interferon regulatory factor 7" /id="PRO_0000154562"
11-126 DNA_BIND /note="IRF tryptophan pentad repeat"
69-88 REGION /note="Disordered"
133-156 REGION /note="Disordered"
242-277 REGION /note="Disordered"
284-456 REGION /note="Necessary for the interaction with NMI"
1-503 DISORDER predicted by DISOPRED

MONOMER
503
pdb_id a1 identity[%]2 description
2o61 C 99.1
3dsh A 33.3
1qwt B 30.8
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.