Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3217688 752 167 Q8NHX9(TPC2_HUMAN) RecName: Full=Two pore channel protein 2;AltName: Full=Two pore calcium channel protein 2;
QUERYSEQ
MAEPQAESEPLLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYRSINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEPPCGLTESVEVLCLLVFAADLSVKGYLFGWA
HFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGS
LFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSIC
VFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSLWDMTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINL
FRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLDAYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERLSQHPHLWL
CR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q8NHX9(TPC2_HUMAN)]

752
region name description
1-752 CHAIN /note="Two pore channel protein 2" /id="PRO_0000276856"
1-84 TOPO_DOM /note="Cytoplasmic"
85-105 TRANSMEM /note="Helical; Name=S1 of repeat I"
106-127 TOPO_DOM /note="Extracellular"
128-148 TRANSMEM /note="Helical; Name=S2 of repeat I"
149-155 TOPO_DOM /note="Cytoplasmic"
156-176 TRANSMEM /note="Helical; Name=S3 of repeat I"
177-183 TOPO_DOM /note="Extracellular"
184-204 TRANSMEM /note="Helical; Name=S4 of repeat I"
205-218 TOPO_DOM /note="Cytoplasmic"
219-239 TRANSMEM /note="Helical; Name=S5 of repeat I"
240-254 TOPO_DOM /note="Extracellular"
280-289 TOPO_DOM /note="Extracellular"
290-310 TRANSMEM /note="Helical; Name=S6 of repeat I"
311-436 TOPO_DOM /note="Cytoplasmic"
437-459 TRANSMEM /note="Helical; Name=S1 of repeat II"
460-465 TOPO_DOM /note="Extracellular"
466-486 TRANSMEM /note="Helical; Name=S2 of repeat II"
487-502 TOPO_DOM /note="Cytoplasmic"
503-523 TRANSMEM /note="Helical; Name=S3 of repeat II"
524-554 TOPO_DOM /note="Extracellular"
555-575 TRANSMEM /note="Helical; Name=S4 of repeat II"
576-580 TOPO_DOM /note="Cytoplasmic"
581-601 TRANSMEM /note="Helical; Name=S5 of repeat II"
602-635 TOPO_DOM /note="Extracellular"
659-673 TOPO_DOM /note="Extracellular"
674-694 TRANSMEM /note="Helical; Name=S6 of repeat II"
695-752 TOPO_DOM /note="Cytoplasmic"
203-207 REGION /note="Interaction with phosphatidylinositol 3,5- bisphosphate"
1-752 DISORDER predicted by DISOPRED

MONOMER
752
pdb_id a1 identity[%]2 description
8ouo A 99.8
6a91 A 26.8
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.