Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3198838 791 6 Q8NAC3(I17RC_HUMAN) RecName: Full=Interleukin-17 receptor C; Short=IL-17 receptor C; Short=IL-17RC;AltName: Full=Interleukin-17 receptor homolog; Short=IL17Rhom;AltName: Full=Interleukin-17 receptor-like protein; Short=IL-17RL;AltName: Full=ZcytoR14;Flags: Precursor;
QUERYSEQ
MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPVSLEPWGDEERLRVQFLAQQSLSLAPVTAATARTALSGLSGADGRREERGRGKSWVCLSLGGSGNTEPQKKGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETD
CDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPDCRGLEVWNSIPSCWALPWLNVSADGDNVHLVLNVSE
EQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICPFREDPRAHQNLWQAARLQLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWENVTVDKVLEFPLLKGHPNLCVQVNSSEKLQL
QECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPSGCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWALVWLACLLFAAALSLILLLKKDHAKGWLRLLKQDVRSGAAARGRAALLLYSADDSGFERL
VGALASALCQLPLRVAVDLWSRRELSAQGPVAWFHAQRRQTLQEGGVVVLLFSPGAVALCSEWLQDGVSGPGAHGPHDAFRASLSCVLPDFLQGRAPGSYVGACFDRLLHPDAVPALFRTVPVFTLPSQLPDFLGALQQPRAPRSGRLQE
RAEQVSRALQPALDSYFHPPGTPAPGRGVGPGAGPGAGDGT
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q8NAC3(I17RC_HUMAN)]

791
region name description
1-20 SIGNAL
21-791 CHAIN /note="Interleukin-17 receptor C" /id="PRO_0000011034"
21-538 TOPO_DOM /note="Extracellular"
539-559 TRANSMEM /note="Helical"
560-791 TOPO_DOM /note="Cytoplasmic"
583-735 DOMAIN /note="SEFIR"
762-791 REGION /note="Disordered"
1-791 DISORDER predicted by DISOPRED

MONOMER
791
pdb_id a1 identity[%]2 description
7zan D 99.8
4nux A 26.8
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.