Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1223590 791 6 Q8NAC3(I17RC_HUMAN) RecName: Full=Interleukin-17 receptor C; Short=IL-17 receptor C; Short=IL-17RC;AltName: Full=Interleukin-17 receptor homolog; Short=IL17Rhom;AltName: Full=Interleukin-17 receptor-like protein; Short=IL-17RL;AltName: Full=ZcytoR14;Flags: Precursor;
QUERYSEQ 
MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPVSLEPWGDEERLRVQFLAQQSLSLAPVTAATARTALSGLSGADGRREERGRGKSWVCLSLGGSGNTEPQKKGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETD
CDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPDCRGLEVWNSIPSCWALPWLNVSADGDNVHLVLNVSE
EQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICPFREDPRAHQNLWQAARLQLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWENVTVDKVLEFPLLKGHPNLCVQVNSSEKLQL
QECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPSGCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWALVWLACLLFAAALSLILLLKKDHAKGWLRLLKQDVRSGAAARGRAALLLYSADDSGFERL
VGALASALCQLPLRVAVDLWSRRELSAQGPVAWFHAQRRQTLQEGGVVVLLFSPGAVALCSEWLQDGVSGPGAHGPHDAFRASLSCVLPDFLQGRAPGSYVGACFDRLLHPDAVPALFRTVPVFTLPSQLPDFLGALQQPRAPRSGRLQE
RAEQVSRALQPALDSYFHPPGTPAPGRGVGPGAGPGAGDGT
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q8NAC3(I17RC_HUMAN)]

791
region name description
1-20 SIGNAL
21-791 CHAIN /note="Interleukin-17 receptor C" /id="PRO_0000011034"
21-538 TOPO_DOM /note="Extracellular"
539-559 TRANSMEM /note="Helical"
560-791 TOPO_DOM /note="Cytoplasmic"
583-735 DOMAIN /note="SEFIR"
762-791 REGION /note="Disordered"
1-791 DISORDER predicted by DISOPRED

MONOMER
791
pdb_id a1 identity[%]2 description
7zan D 99.8 I17RC_HUMAN Isoform 2 of Interleukin-17 receptor C
4nux A 26.8 I17RA_HUMAN Interleukin-17 receptor A 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
791 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7uwn[3] A IL17_HUMAN Interleukin-17A[111 aa] G 100.0
/99.7		 15
/15		 I17RC_HUMAN Isoform 5 of Interleukin-17 receptor C
7uwn[3] B IL17_HUMAN Interleukin-17A[111 aa] G 100.0
/99.7		 8
/8		 I17RC_HUMAN Isoform 5 of Interleukin-17 receptor C
6hg4[8] A IL17F_HUMAN Interleukin-17F[104 aa] B 100.0
/98.1		 19
/19		 I17RC_HUMAN Interleukin-17 receptor C
6hga[1] C anti-APP-tag Fab light-chain[219 aa] A 100.0
/98.1		 8
/11		 I17RC_HUMAN Interleukin-17 receptor C
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
791 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6hga[1] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/98.1		 2
/2		 I17RC_HUMAN Interleukin-17 receptor C
7uwn[3] P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		G 100.0
/99.7		 1
/1		 I17RC_HUMAN Isoform 5 of Interleukin-17 receptor C
7uwn[1] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		G 100.0
/99.7		 2
/2		 I17RC_HUMAN Isoform 5 of Interleukin-17 receptor C
7zan[2] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		D 100.0
/99.8		 2
/2		 I17RC_HUMAN Isoform 2 of Interleukin-17 receptor C
7zan[2] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		D 100.0
/99.8		 2
/2		 I17RC_HUMAN Isoform 2 of Interleukin-17 receptor C
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
791 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6hg4[2] B I17RC_HUMAN Interleukin-17 receptor C[427 aa] B 100.0
/98.1		 1
/1		 I17RC_HUMAN Interleukin-17 receptor C
6hg9[2] B I17RC_HUMAN Interleukin-17 receptor C[423 aa] B 100.0
/98.1		 3
/3		 I17RC_HUMAN Interleukin-17 receptor C
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.