HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

101737

580

139

Q86U44(MTA70_HUMAN)

RecName: Full=N6-adenosine-methyltransferase catalytic subunit ; EC=2.1.1.348 ;AltName: Full=Methyltransferase-like protein 3 ; Short=hMETTL3 ;AltName: Full=N6-adenosine-methyltransferase 70 kDa subunit; Short=MT-A70;

QUERYSEQ

MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADH
SKLSAMMGAVAEKKGPGEVAGTVTGQKRRAEQDSTTVAAFASSLVSGLNSSASEPAKEPAKKSRKHAASDVDLEIESLLNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR
RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYE
RVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q86U44(MTA70_HUMAN)]

580
	region	name	description
	2-580	CHAIN	/note="N6-adenosine-methyltransferase catalytic subunit" /id="PRO_0000207630"
	1-70	REGION	/note="Disordered"
	198-219	REGION	/note="Disordered"
	396-410	REGION	/note="Gate loop 1"
	450-454	REGION	/note="Interaction with METTL14" ECO:0007744\|PDB:5IL0, ECO:0007744\|PDB:5IL1, ECO:0007744\|PDB:5IL2"
	462-479	REGION	/note="Interphase loop"
	464-480	REGION	/note="Interaction with METTL14" ECO:0007744\|PDB:5IL0, ECO:0007744\|PDB:5IL1, ECO:0007744\|PDB:5IL2"
	465-478	REGION	/note="Positively charged region required for RNA-binding"
	507-515	REGION	/note="Gate loop 2"
	13-34	COMPBIAS	/note="Basic and acidic residues"
	43-64	COMPBIAS	/note="Polar residues"
	377-378	BINDING	/ligand="S-adenosyl-L-methionine" /ligand_id="ChEBI:CHEBI:59789" ECO:0000269\|PubMed:27373337, ECO:0000269\|PubMed:27627798, ECO:0007744\|PDB:5IL1, ECO:0007744\|PDB:5IL2, ECO:0007744\|PDB:5K7U, ECO:0007744\|PDB:5K7W, ECO:0007744\|PDB:5L6D, ECO:0007744\|PDB:5L6E"
	395-395	BINDING	/ligand="S-adenosyl-L-methionine" /ligand_id="ChEBI:CHEBI:59789" ECO:0000269\|PubMed:27373337, ECO:0007744\|PDB:5IL1, ECO:0007744\|PDB:5IL2, ECO:0007744\|PDB:5K7U, ECO:0007744\|PDB:5K7W"
	513-513	BINDING	/ligand="S-adenosyl-L-methionine" /ligand_id="ChEBI:CHEBI:59789" ECO:0000269\|PubMed:27373337, ECO:0007744\|PDB:5IL1, ECO:0007744\|PDB:5IL2, ECO:0007744\|PDB:5K7U, ECO:0007744\|PDB:5K7W"
	536-539	BINDING	/ligand="S-adenosyl-L-methionine" /ligand_id="ChEBI:CHEBI:59789" ECO:0000269\|PubMed:27373337, ECO:0000269\|PubMed:27627798, ECO:0007744\|PDB:5IL1, ECO:0007744\|PDB:5IL2, ECO:0007744\|PDB:5K7U, ECO:0007744\|PDB:5K7W, ECO:0007744\|PDB:5L6D, ECO:0007744\|PDB:5L6E"
	549-550	BINDING	/ligand="S-adenosyl-L-methionine" /ligand_id="ChEBI:CHEBI:59789" ECO:0000269\|PubMed:27373337, ECO:0000269\|PubMed:27627798, ECO:0007744\|PDB:5IL1, ECO:0007744\|PDB:5IL2, ECO:0007744\|PDB:5K7U, ECO:0007744\|PDB:5K7W, ECO:0007744\|PDB:5L6D, ECO:0007744\|PDB:5L6E"
	1-580	DISORDER	predicted by DISOPRED

MONOMER

580

pdb_id a¹ identity[%]² description

5il0 A 100.0 MTA70_HUMAN METTL3

5yz9 A 99.0 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

580 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5il0[9] B MET14_HUMAN METTL14[282 aa] A 100.0
/100.0 44
/44 MTA70_HUMAN METTL3

5l6d[39] B MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14[238.. A 100.0
/100.0 40
/40 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

5tey[8] B MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14[241.. A 100.0
/99.5 40
/40 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

7f4s[1] E A0E887_PARTE MTA9[213 aa] C 35.5
/42.1 31
/31 Q22GC0_TETTS MT-a70 family protein

7f4t[4] E A0DWP1_PARTE Ptep2[125 aa] A 55.6
/41.9 9
/29 Q22GC0_TETTS MT-a70 family protein

7f4s[1] F A0E887_PARTE MTA9[192 aa] B 36.7
/41.3 30
/30 Q22GC0_TETTS MT-a70 family protein

7f4l[9] A I7M8B9_TETTS Transmembrane protein, putative[130 aa] B 50.0
/43.7 12
/36 Q22GC0_TETTS MT-a70 family protein

7yi8[2] D I7M8B9_TETTS Transmembrane protein, putative[122 aa] B 60.0
/41.3 10
/33 Q22GC0_TETTS MT-a70 family protein

7yi8[2] A I7MIF9_TETTS MTA9[257 aa] B 41.9
/41.3 31
/31 Q22GC0_TETTS MT-a70 family protein

7f4s[1] D A0E887_PARTE MTA9[215 aa] A 38.5
/41.0 26
/26 Q22GC0_TETTS MT-a70 family protein

5il0[48] A MTA70_HUMAN METTL3[211 aa] B 30.8
/38.7 26
/56 MET14_HUMAN METTL14

5tey[8] A MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit[205 .. B 34.6
/39.6 26
/42 MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

580 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6ttp[1] C ADN
ADENOSINE[19 atoms] A 100.0
/100.0 12
/12 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

6ttt[1] C NWQ
(2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-~{.. A 100.0
/100.0 13
/13 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

6ttv[1] C NWW
(2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,.. A 100.0
/100.0 13
/13 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

6ttw[1] C NWZ
(2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,.. A 100.0
/100.0 16
/16 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

6ttx[1] C NX8
(2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,.. A 100.0
/100.0 15
/15 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

6tu1[1] C NXB
(2~{R},3~{R},4~{R},5~{R})-2-[(6-aminopurin-9-yl)me.. A 100.0
/100.0 13
/13 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

6y4g[1] C SFG
SINEFUNGIN[27 atoms] A 100.0
/100.0 19
/19 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7acd[1] C R72
4-[(4,4-dimethylpiperidin-1-yl)methyl]-2-oxidanyl-.. A 100.0
/100.0 20
/20 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7nhg[1] C UDQ
N-[[(3R)-3-Hydroxy-1-[6-(methylamino)pyrimidin-4-y.. A 100.0
/100.0 16
/16 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7nhh[1] F UDK
(R)-N-((3-hydroxy-1-(6-(methylamino)pyrimidin-4-yl.. A 100.0
/100.0 17
/17 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7nhi[1] C UE2
(R)-N-((3-hydroxy-1-(6-(methylamino)pyrimidin-4-yl.. A 100.0
/100.0 17
/17 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7nhj[1] C UDW
(S)-3-(((6-(3-(hydroxymethyl)piperidin-1-yl)pyrimi.. A 100.0
/100.0 14
/14 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7nhv[1] C UE5
(R)-N-((1-(6-(benzylamino)pyrimidin-4-yl)-3-hydrox.. A 100.0
/100.0 18
/18 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7ni7[1] C UEH
(R)-4-((4,4-dimethylpiperidin-1-yl)methyl)-2-hydro.. A 100.0
/100.0 19
/19 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7ni8[2] C UEE
(R)-4-((2-azaspiro[3.3]heptan-2-yl)methyl)-N-((1-(.. A 100.0
/100.0 19
/19 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7ni9[1] C UEW
N-(((R)-1-(6-(benzylamino)pyrimidin-4-yl)-3-hydrox.. A 100.0
/100.0 22
/22 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7nia[1] C UEQ
4-[[(3R)-3-cyclopropyl-2-azaspiro[3.3]heptan-2-yl].. A 100.0
/100.0 20
/20 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7nid[1] C UEZ
(R)-1-(6-(benzylamino)pyrimidin-4-yl)-3-(((6-((4,4.. A 100.0
/100.0 19
/19 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o08[1] C UXE
4-[[[6-[(4,4-dimethylpiperidin-1-yl)methyl]pyridin.. A 100.0
/100.0 19
/19 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o09[1] C UXK
6-[4-[6-[(4,4-dimethylpiperidin-1-yl)methyl]pyridi.. A 100.0
/100.0 20
/20 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o0l[1] D UXW
4-[6-[(4,4-dimethylpiperidin-1-yl)methyl]pyridin-3.. B 100.0
/100.0 20
/20 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o0m[1] C UXT
4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-9.. A 100.0
/100.0 20
/20 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o0p[1] C UXZ
4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-9.. A 100.0
/100.0 19
/19 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o0q[1] C UY2
3-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-8.. A 100.0
/100.0 18
/18 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o0r[1] C UY5
4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-9.. A 100.0
/100.0 21
/21 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o27[1] C UYZ
4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-9.. A 100.0
/100.0 18
/18 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o28[1] C UZB
9-(2-chloranyl-7~{H}-pyrrolo[2,3-d]pyrimidin-4-yl).. A 100.0
/100.0 19
/19 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o29[1] C UZE
4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]-2-fluora.. A 100.0
/100.0 17
/17 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o2e[1] C UZH
4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]-3-fluora.. A 100.0
/100.0 19
/19 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o2f[1] C UZ5
4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]-2,5-bis(.. A 100.0
/100.0 18
/18 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o2h[1] C UZ2
4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-1.. A 100.0
/100.0 17
/17 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o2i[1] C V22
~{N}-[[6-[(cyclohexylmethylamino)methyl]imidazo[1,.. A 100.0
/100.0 20
/20 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o2x[1] C V0B
N-[(6-methylimidazo[1,2-a]pyridin-2-yl)methyl]-4-o.. A 100.0
/100.0 17
/17 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oed[1] C VB5
4-[(4,4-dimethylpiperidin-1-yl)methyl]-~{N}-[[(3~{.. A 100.0
/100.0 19
/19 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oee[1] C VB2
4-[(4,4-dimethylpiperidin-1-yl)methyl]-~{N}-[[(3~{.. A 100.0
/100.0 20
/20 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oef[1] C VAT
4-(2-azaspiro[3.4]octan-2-ylmethyl)-~{N}-[[(3~{R}).. A 100.0
/100.0 20
/20 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oeh[1] C 6IK
4-[[(3S)-3-cyclopropyl-2-azaspiro[3.3]heptan-2-yl].. A 100.0
/100.0 24
/24 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oei[1] C V9W
(3~{R})-3-[[5-[(4,4-dimethylpiperidin-1-yl)methyl].. A 100.0
/100.0 17
/17 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oej[1] C V9T
4-[[(3S)-3-cyclopropyl-2-azaspiro[3.3]heptan-2-yl].. A 100.0
/100.0 21
/21 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oek[1] C VAQ
4-[[(3S)-3-cyclopropyl-2-azaspiro[3.3]heptan-2-yl].. A 100.0
/100.0 23
/23 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oel[1] C VA8
~{N}-[[(3~{R})-1-[6-(3~{H}-benzimidazol-4-ylmethyl.. A 100.0
/100.0 19
/19 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oem[1] E VB8
4-[(4,4-dimethylpiperidin-1-yl)methyl]-2-methylsul.. A 100.0
/100.0 21
/21 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oql[1] C 0AE
(3~{R})-1-[6-[(phenylmethyl)amino]pyrimidin-4-yl]-.. A 100.0
/100.0 21
/21 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oqo[1] C 0BA
2-oxidanyl-N-[[(3R)-3-oxidanyl-1-(7H-pyrrolo[2,3-d.. A 100.0
/100.0 19
/19 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7oqp[1] C 0BH
N-[[(3R)-1-[6-(1-benzothiophen-4-ylmethylamino)pyr.. A 100.0
/100.0 24
/24 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

5il1[1] C SAM
S-ADENOSYLMETHIONINE[27 atoms] A 100.0
/100.0 20
/20 MTA70_HUMAN METTL3

5k7u[2] C SAM
S-ADENOSYLMETHIONINE[27 atoms] A 100.0
/100.0 18
/18 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

7f4m[7] G SAM
S-ADENOSYLMETHIONINE[27 atoms] B 69.2
/43.7 13
/13 Q22GC0_TETTS MT-a70 family protein

7yi9[1] E SAM
S-ADENOSYLMETHIONINE[27 atoms] B 73.3
/41.3 15
/15 Q22GC0_TETTS MT-a70 family protein

5il2[1] C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] A 100.0
/100.0 18
/18 MTA70_HUMAN METTL3

5k7w[2] C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] A 100.0
/100.0 18
/18 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

5tey[1] C SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] A 100.0
/99.5 20
/20 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

7f4n[3] G SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] B 64.3
/43.7 14
/14 Q22GC0_TETTS MT-a70 family protein

7yi8[1] E SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms] B 75.0
/41.3 12
/12 Q22GC0_TETTS MT-a70 family protein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

580 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5yz9[1] B ZN
ZINC ION[1 atoms] A 100.0
/99.0 4
/4 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

5yz9[1] C ZN
ZINC ION[1 atoms] A 100.0
/99.0 4
/4 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

5tey[1] F UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.5 2
/2 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

5tey[1] G UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.5 3
/3 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

5tey[1] L UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/99.5 1
/1 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

5tey[1] I UNX
UNKNOWN ATOM OR ION[1 atoms] B 25.0
/39.6 4
/4 MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14

5tey[1] K UNX
UNKNOWN ATOM OR ION[1 atoms] B 0.0
/39.6 2
/2 MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14

5tey[1] L UNX
UNKNOWN ATOM OR ION[1 atoms] B 50.0
/39.6 2
/2 MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14

5tey[1] M UNX
UNKNOWN ATOM OR ION[1 atoms] B 0.0
/39.6 2
/2 MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14

5tey[1] N UNX
UNKNOWN ATOM OR ION[1 atoms] B 40.0
/39.6 5
/5 MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14

5il0[1] E BR
BROMIDE ION[1 atoms] B 50.0
/38.7 4
/5 MET14_HUMAN METTL14

5l6d[1] D MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 2
/2 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

5l6e[1] D MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 1
/1 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

5tey[1] D MG
MAGNESIUM ION[1 atoms] A 100.0
/99.5 2
/2 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

7acd[5] D MG
MAGNESIUM ION[1 atoms] B 0.0
/38.0 2
/3 MET14_HUMAN N6-adenosine-methyltransferase non-catalytic subun..

7nhh[2] C MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 3
/3 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7nhh[2] D MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 2
/2 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7nhh[1] E MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 2
/2 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7nhh[2] C MG
MAGNESIUM ION[1 atoms] B 0.0
/37.7 2
/2 MET14_HUMAN N6-adenosine-methyltransferase non-catalytic subun..

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

580 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7o2i[1] D DMS
DIMETHYL SULFOXIDE[4 atoms] A 100.0
/100.0 1
/1 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

7o2i[1] D DMS
DIMETHYL SULFOXIDE[4 atoms] B 50.0
/40.5 4
/4 MET14_HUMAN N6-adenosine-methyltransferase non-catalytic subun..

5l6d[2] E ACT
ACETATE ION[4 atoms] A 100.0
/100.0 1
/1 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

5l6d[40] E ACT
ACETATE ION[4 atoms] B 50.0
/40.2 4
/4 MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14

6ttp[7] D ACT
ACETATE ION[4 atoms] A 100.0
/100.0 1
/1 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

6ttp[7] D ACT
ACETATE ION[4 atoms] B 50.0
/39.0 4
/4 MET14_HUMAN N6-adenosine-methyltransferase non-catalytic subun..

7nhg[36] D ACT
ACETATE ION[4 atoms] A 100.0
/100.0 1
/1 MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit

5il0[1] C EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 5
/5 MTA70_HUMAN METTL3

5il0[1] D EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 1
/1 MTA70_HUMAN METTL3

5il0[1] D EDO
1,2-ETHANEDIOL[4 atoms] B 40.0
/38.7 5
/7 MET14_HUMAN METTL14

5il1[2] D EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 MTA70_HUMAN METTL3

5il1[2] E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 1
/1 MTA70_HUMAN METTL3

5il1[2] E EDO
1,2-ETHANEDIOL[4 atoms] B 0.0
/37.9 2
/2 MET14_HUMAN METTL14

5il1[2] F EDO
1,2-ETHANEDIOL[4 atoms] B 42.9
/37.9 7
/7 MET14_HUMAN METTL14

5il2[1] G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 1
/1 MTA70_HUMAN METTL3

5il2[1] G EDO
1,2-ETHANEDIOL[4 atoms] B 0.0
/37.9 3
/3 MET14_HUMAN METTL14

5tey[1] E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/99.5 3
/3 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

5tey[1] E EDO
1,2-ETHANEDIOL[4 atoms] B 0.0
/39.6 1
/1 MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14

5tey[1] H BME
BETA-MERCAPTOETHANOL[4 atoms] A 100.0
/99.5 4
/4 MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit

5tey[1] H BME
BETA-MERCAPTOETHANOL[4 atoms] B 0.0
/39.6 4
/4 MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
580
	pdb_id	a¹	identity[%]²	description
	5il0	A	100.0	MTA70_HUMAN METTL3
	5yz9	A	99.0	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
580	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5il0[9]	B	MET14_HUMAN METTL14[282 aa]	A	100.0 /100.0	44 /44	MTA70_HUMAN METTL3
	5l6d[39]	B	MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14[238..	A	100.0 /100.0	40 /40	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	5tey[8]	B	MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14[241..	A	100.0 /99.5	40 /40	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	7f4s[1]	E	A0E887_PARTE MTA9[213 aa]	C	35.5 /42.1	31 /31	Q22GC0_TETTS MT-a70 family protein
	7f4t[4]	E	A0DWP1_PARTE Ptep2[125 aa]	A	55.6 /41.9	9 /29	Q22GC0_TETTS MT-a70 family protein
	7f4s[1]	F	A0E887_PARTE MTA9[192 aa]	B	36.7 /41.3	30 /30	Q22GC0_TETTS MT-a70 family protein
	7f4l[9]	A	I7M8B9_TETTS Transmembrane protein, putative[130 aa]	B	50.0 /43.7	12 /36	Q22GC0_TETTS MT-a70 family protein
	7yi8[2]	D	I7M8B9_TETTS Transmembrane protein, putative[122 aa]	B	60.0 /41.3	10 /33	Q22GC0_TETTS MT-a70 family protein
	7yi8[2]	A	I7MIF9_TETTS MTA9[257 aa]	B	41.9 /41.3	31 /31	Q22GC0_TETTS MT-a70 family protein
	7f4s[1]	D	A0E887_PARTE MTA9[215 aa]	A	38.5 /41.0	26 /26	Q22GC0_TETTS MT-a70 family protein
	5il0[48]	A	MTA70_HUMAN METTL3[211 aa]	B	30.8 /38.7	26 /56	MET14_HUMAN METTL14
	5tey[8]	A	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit[205 ..	B	34.6 /39.6	26 /42	MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
580	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6ttp[1]	C	ADN ADENOSINE[19 atoms]	A	100.0 /100.0	12 /12	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	6ttt[1]	C	NWQ (2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-~{..	A	100.0 /100.0	13 /13	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	6ttv[1]	C	NWW (2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,..	A	100.0 /100.0	13 /13	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	6ttw[1]	C	NWZ (2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,..	A	100.0 /100.0	16 /16	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	6ttx[1]	C	NX8 (2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,..	A	100.0 /100.0	15 /15	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	6tu1[1]	C	NXB (2~{R},3~{R},4~{R},5~{R})-2-[(6-aminopurin-9-yl)me..	A	100.0 /100.0	13 /13	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	6y4g[1]	C	SFG SINEFUNGIN[27 atoms]	A	100.0 /100.0	19 /19	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7acd[1]	C	R72 4-[(4,4-dimethylpiperidin-1-yl)methyl]-2-oxidanyl-..	A	100.0 /100.0	20 /20	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7nhg[1]	C	UDQ N-[[(3R)-3-Hydroxy-1-[6-(methylamino)pyrimidin-4-y..	A	100.0 /100.0	16 /16	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7nhh[1]	F	UDK (R)-N-((3-hydroxy-1-(6-(methylamino)pyrimidin-4-yl..	A	100.0 /100.0	17 /17	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7nhi[1]	C	UE2 (R)-N-((3-hydroxy-1-(6-(methylamino)pyrimidin-4-yl..	A	100.0 /100.0	17 /17	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7nhj[1]	C	UDW (S)-3-(((6-(3-(hydroxymethyl)piperidin-1-yl)pyrimi..	A	100.0 /100.0	14 /14	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7nhv[1]	C	UE5 (R)-N-((1-(6-(benzylamino)pyrimidin-4-yl)-3-hydrox..	A	100.0 /100.0	18 /18	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7ni7[1]	C	UEH (R)-4-((4,4-dimethylpiperidin-1-yl)methyl)-2-hydro..	A	100.0 /100.0	19 /19	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7ni8[2]	C	UEE (R)-4-((2-azaspiro[3.3]heptan-2-yl)methyl)-N-((1-(..	A	100.0 /100.0	19 /19	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7ni9[1]	C	UEW N-(((R)-1-(6-(benzylamino)pyrimidin-4-yl)-3-hydrox..	A	100.0 /100.0	22 /22	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7nia[1]	C	UEQ 4-[[(3R)-3-cyclopropyl-2-azaspiro[3.3]heptan-2-yl]..	A	100.0 /100.0	20 /20	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7nid[1]	C	UEZ (R)-1-(6-(benzylamino)pyrimidin-4-yl)-3-(((6-((4,4..	A	100.0 /100.0	19 /19	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o08[1]	C	UXE 4-[[[6-[(4,4-dimethylpiperidin-1-yl)methyl]pyridin..	A	100.0 /100.0	19 /19	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o09[1]	C	UXK 6-[4-[6-[(4,4-dimethylpiperidin-1-yl)methyl]pyridi..	A	100.0 /100.0	20 /20	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o0l[1]	D	UXW 4-[6-[(4,4-dimethylpiperidin-1-yl)methyl]pyridin-3..	B	100.0 /100.0	20 /20	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o0m[1]	C	UXT 4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-9..	A	100.0 /100.0	20 /20	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o0p[1]	C	UXZ 4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-9..	A	100.0 /100.0	19 /19	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o0q[1]	C	UY2 3-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-8..	A	100.0 /100.0	18 /18	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o0r[1]	C	UY5 4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-9..	A	100.0 /100.0	21 /21	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o27[1]	C	UYZ 4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-9..	A	100.0 /100.0	18 /18	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o28[1]	C	UZB 9-(2-chloranyl-7~{H}-pyrrolo[2,3-d]pyrimidin-4-yl)..	A	100.0 /100.0	19 /19	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o29[1]	C	UZE 4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]-2-fluora..	A	100.0 /100.0	17 /17	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o2e[1]	C	UZH 4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]-3-fluora..	A	100.0 /100.0	19 /19	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o2f[1]	C	UZ5 4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]-2,5-bis(..	A	100.0 /100.0	18 /18	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o2h[1]	C	UZ2 4-[4-[(4,4-dimethylpiperidin-1-yl)methyl]phenyl]-1..	A	100.0 /100.0	17 /17	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o2i[1]	C	V22 ~{N}-[[6-[(cyclohexylmethylamino)methyl]imidazo[1,..	A	100.0 /100.0	20 /20	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o2x[1]	C	V0B N-[(6-methylimidazo[1,2-a]pyridin-2-yl)methyl]-4-o..	A	100.0 /100.0	17 /17	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oed[1]	C	VB5 4-[(4,4-dimethylpiperidin-1-yl)methyl]-~{N}-[[(3~{..	A	100.0 /100.0	19 /19	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oee[1]	C	VB2 4-[(4,4-dimethylpiperidin-1-yl)methyl]-~{N}-[[(3~{..	A	100.0 /100.0	20 /20	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oef[1]	C	VAT 4-(2-azaspiro[3.4]octan-2-ylmethyl)-~{N}-[[(3~{R})..	A	100.0 /100.0	20 /20	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oeh[1]	C	6IK 4-[[(3S)-3-cyclopropyl-2-azaspiro[3.3]heptan-2-yl]..	A	100.0 /100.0	24 /24	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oei[1]	C	V9W (3~{R})-3-[[5-[(4,4-dimethylpiperidin-1-yl)methyl]..	A	100.0 /100.0	17 /17	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oej[1]	C	V9T 4-[[(3S)-3-cyclopropyl-2-azaspiro[3.3]heptan-2-yl]..	A	100.0 /100.0	21 /21	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oek[1]	C	VAQ 4-[[(3S)-3-cyclopropyl-2-azaspiro[3.3]heptan-2-yl]..	A	100.0 /100.0	23 /23	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oel[1]	C	VA8 ~{N}-[[(3~{R})-1-[6-(3~{H}-benzimidazol-4-ylmethyl..	A	100.0 /100.0	19 /19	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oem[1]	E	VB8 4-[(4,4-dimethylpiperidin-1-yl)methyl]-2-methylsul..	A	100.0 /100.0	21 /21	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oql[1]	C	0AE (3~{R})-1-[6-[(phenylmethyl)amino]pyrimidin-4-yl]-..	A	100.0 /100.0	21 /21	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oqo[1]	C	0BA 2-oxidanyl-N-[[(3R)-3-oxidanyl-1-(7H-pyrrolo[2,3-d..	A	100.0 /100.0	19 /19	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7oqp[1]	C	0BH N-[[(3R)-1-[6-(1-benzothiophen-4-ylmethylamino)pyr..	A	100.0 /100.0	24 /24	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	5il1[1]	C	SAM S-ADENOSYLMETHIONINE[27 atoms]	A	100.0 /100.0	20 /20	MTA70_HUMAN METTL3
	5k7u[2]	C	SAM S-ADENOSYLMETHIONINE[27 atoms]	A	100.0 /100.0	18 /18	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	7f4m[7]	G	SAM S-ADENOSYLMETHIONINE[27 atoms]	B	69.2 /43.7	13 /13	Q22GC0_TETTS MT-a70 family protein
	7yi9[1]	E	SAM S-ADENOSYLMETHIONINE[27 atoms]	B	73.3 /41.3	15 /15	Q22GC0_TETTS MT-a70 family protein
	5il2[1]	C	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	A	100.0 /100.0	18 /18	MTA70_HUMAN METTL3
	5k7w[2]	C	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	A	100.0 /100.0	18 /18	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	5tey[1]	C	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	A	100.0 /99.5	20 /20	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	7f4n[3]	G	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	B	64.3 /43.7	14 /14	Q22GC0_TETTS MT-a70 family protein
	7yi8[1]	E	SAH S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]	B	75.0 /41.3	12 /12	Q22GC0_TETTS MT-a70 family protein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
580	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5yz9[1]	B	ZN ZINC ION[1 atoms]	A	100.0 /99.0	4 /4	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	5yz9[1]	C	ZN ZINC ION[1 atoms]	A	100.0 /99.0	4 /4	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	5tey[1]	F	UNX UNKNOWN ATOM OR ION[1 atoms]	A	100.0 /99.5	2 /2	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	5tey[1]	G	UNX UNKNOWN ATOM OR ION[1 atoms]	A	100.0 /99.5	3 /3	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	5tey[1]	L	UNX UNKNOWN ATOM OR ION[1 atoms]	A	100.0 /99.5	1 /1	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	5tey[1]	I	UNX UNKNOWN ATOM OR ION[1 atoms]	B	25.0 /39.6	4 /4	MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14
	5tey[1]	K	UNX UNKNOWN ATOM OR ION[1 atoms]	B	0.0 /39.6	2 /2	MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14
	5tey[1]	L	UNX UNKNOWN ATOM OR ION[1 atoms]	B	50.0 /39.6	2 /2	MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14
	5tey[1]	M	UNX UNKNOWN ATOM OR ION[1 atoms]	B	0.0 /39.6	2 /2	MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14
	5tey[1]	N	UNX UNKNOWN ATOM OR ION[1 atoms]	B	40.0 /39.6	5 /5	MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14
	5il0[1]	E	BR BROMIDE ION[1 atoms]	B	50.0 /38.7	4 /5	MET14_HUMAN METTL14
	5l6d[1]	D	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	2 /2	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	5l6e[1]	D	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	1 /1	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	5tey[1]	D	MG MAGNESIUM ION[1 atoms]	A	100.0 /99.5	2 /2	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	7acd[5]	D	MG MAGNESIUM ION[1 atoms]	B	0.0 /38.0	2 /3	MET14_HUMAN N6-adenosine-methyltransferase non-catalytic subun..
	7nhh[2]	C	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	3 /3	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7nhh[2]	D	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	2 /2	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7nhh[1]	E	MG MAGNESIUM ION[1 atoms]	A	100.0 /100.0	2 /2	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7nhh[2]	C	MG MAGNESIUM ION[1 atoms]	B	0.0 /37.7	2 /2	MET14_HUMAN N6-adenosine-methyltransferase non-catalytic subun..
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
580	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7o2i[1]	D	DMS DIMETHYL SULFOXIDE[4 atoms]	A	100.0 /100.0	1 /1	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	7o2i[1]	D	DMS DIMETHYL SULFOXIDE[4 atoms]	B	50.0 /40.5	4 /4	MET14_HUMAN N6-adenosine-methyltransferase non-catalytic subun..
	5l6d[2]	E	ACT ACETATE ION[4 atoms]	A	100.0 /100.0	1 /1	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	5l6d[40]	E	ACT ACETATE ION[4 atoms]	B	50.0 /40.2	4 /4	MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14
	6ttp[7]	D	ACT ACETATE ION[4 atoms]	A	100.0 /100.0	1 /1	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	6ttp[7]	D	ACT ACETATE ION[4 atoms]	B	50.0 /39.0	4 /4	MET14_HUMAN N6-adenosine-methyltransferase non-catalytic subun..
	7nhg[36]	D	ACT ACETATE ION[4 atoms]	A	100.0 /100.0	1 /1	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit
	5il0[1]	C	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	5 /5	MTA70_HUMAN METTL3
	5il0[1]	D	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	1 /1	MTA70_HUMAN METTL3
	5il0[1]	D	EDO 1,2-ETHANEDIOL[4 atoms]	B	40.0 /38.7	5 /7	MET14_HUMAN METTL14
	5il1[2]	D	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	4 /4	MTA70_HUMAN METTL3
	5il1[2]	E	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	1 /1	MTA70_HUMAN METTL3
	5il1[2]	E	EDO 1,2-ETHANEDIOL[4 atoms]	B	0.0 /37.9	2 /2	MET14_HUMAN METTL14
	5il1[2]	F	EDO 1,2-ETHANEDIOL[4 atoms]	B	42.9 /37.9	7 /7	MET14_HUMAN METTL14
	5il2[1]	G	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	1 /1	MTA70_HUMAN METTL3
	5il2[1]	G	EDO 1,2-ETHANEDIOL[4 atoms]	B	0.0 /37.9	3 /3	MET14_HUMAN METTL14
	5tey[1]	E	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /99.5	3 /3	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	5tey[1]	E	EDO 1,2-ETHANEDIOL[4 atoms]	B	0.0 /39.6	1 /1	MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14
	5tey[1]	H	BME BETA-MERCAPTOETHANOL[4 atoms]	A	100.0 /99.5	4 /4	MTA70_HUMAN N6-adenosine-methyltransferase 70 kDa subunit
	5tey[1]	H	BME BETA-MERCAPTOETHANOL[4 atoms]	B	0.0 /39.6	4 /4	MET14_HUMAN N6-adenosine-methyltransferase subunit METTL14
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [Q86U44(MTA70_HUMAN)]