Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1223585 84 0 Q80H93(NS8B_SARS) RecName: Full=ORF8b protein;AltName: Full=Accessory protein 8b;AltName: Full=Non-structural protein 8b; Short=ns8b;
QUERYSEQ
MCLKILVRYNTRGNTYSTAWLCALGKVLPFHRWHTMVQTCTPNVTINCQDPAGGALIARCWYLHEGHQTAAFRDVLVVLNKRTN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q80H93(NS8B_SARS)]

84
region name description
1-84 CHAIN /note="ORF8b protein" /id="PRO_0000106135"
1-82 DOMAIN /note="SARS ORF8 Ig-like"
1-84 DISORDER predicted by DISOPRED

No homologue is found in PDB.

Please check [SiteTable] for homologues.