Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4093875 540 46 Q7Z434(MAVS_HUMAN) RecName: Full=Mitochondrial antiviral-signaling protein ; Short=MAVS ;AltName: Full=CARD adapter inducing interferon beta ; Short=Cardif ;AltName: Full=Interferon beta promoter stimulator protein 1; Short=IPS-1;AltName: Full=Putative NF-kappa-B-activating protein 031N;AltName: Full=Virus-induced-signaling adapter; Short=VISA;
QUERYSEQ 
MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAP
ESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPT
TLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMG
PCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q7Z434(MAVS_HUMAN)]

540
region name description
1-540 CHAIN /note="Mitochondrial antiviral-signaling protein" /id="PRO_0000144096"
1-513 TOPO_DOM /note="Cytoplasmic"
514-534 TRANSMEM /note="Helical"
535-540 TOPO_DOM /note="Mitochondrial intermembrane"
10-77 DOMAIN /note="CARD"
10-77 REGION /note="Required for interaction with NLRX1"
95-297 REGION /note="Disordered"
143-147 REGION /note="Interaction with TRAF2"
153-158 REGION /note="Interaction with TRAF6"
314-358 REGION /note="Disordered"
373-419 REGION /note="Disordered"
455-460 REGION /note="Interaction with TRAF6"
476-507 REGION /note="Disordered"
102-124 COMPBIAS /note="Pro residues"
145-166 COMPBIAS /note="Polar residues"
184-262 COMPBIAS /note="Polar residues"
314-350 COMPBIAS /note="Polar residues"
373-389 COMPBIAS /note="Polar residues"
400-415 COMPBIAS /note="Polar residues"
493-507 COMPBIAS /note="Basic and acidic residues"
79-79 LIPID /note="S-palmitoyl cysteine"
1-533 DISORDER predicted by DISOPRED

MONOMER
540
pdb_id a1 identity[%]2 description
2ms8 A 100.0 MAVS_HUMAN Mitochondrial antiviral-signaling protein 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
540 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4p4h[10] A DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[188 aa] I 100.0
/96.9		 8
/8		 MAVS_HUMAN Mitochondrial antiviral-signaling protein
4p4h[6] B DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[189 aa] I 100.0
/96.9		 7
/7		 MAVS_HUMAN Mitochondrial antiviral-signaling protein
4p4h[3] C DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58[189 aa] I 100.0
/96.9		 1
/1		 MAVS_HUMAN Mitochondrial antiviral-signaling protein
4p4h[3] P RL40_HUMAN Ubiquitin-60S ribosomal protein L40[71 aa] K 100.0
/96.9		 7
/7		 MAVS_HUMAN Mitochondrial antiviral-signaling protein
7dni[4] L UBB_HUMAN Ubiquitin[73 aa] M 100.0
/96.9		 1
/1		 MAVS_HUMAN Mitochondrial antiviral-signaling protein
7dni[5] E IFIH1_HUMAN Interferon-induced helicase C domain-containing pr.. M 100.0
/96.9		 5
/5		 MAVS_HUMAN Mitochondrial antiviral-signaling protein
7dni[3] F IFIH1_HUMAN Interferon-induced helicase C domain-containing pr.. M 100.0
/96.9		 6
/6		 MAVS_HUMAN Mitochondrial antiviral-signaling protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
540 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2ms7[232] B MAVS_HUMAN Mitochondrial antiviral-signaling protein[102 aa] A 100.0
/100.0		 5
/5		 MAVS_HUMAN Mitochondrial antiviral-signaling protein
2ms7[18] D MAVS_HUMAN Mitochondrial antiviral-signaling protein[102 aa] A 100.0
/100.0		 8
/8		 MAVS_HUMAN Mitochondrial antiviral-signaling protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
540 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2vgq[1] D SO4
SULFATE ION[5 atoms] 		A 100.0
/98.9		 5
/5		 A0A0B1N7A9_ECOLX MAVS_HUMAN Sugar ABC transporter substrate-binding protein,Mi..
2vgq[1] E SO4
SULFATE ION[5 atoms] 		A 100.0
/98.9		 2
/2		 A0A0B1N7A9_ECOLX MAVS_HUMAN Sugar ABC transporter substrate-binding protein,Mi..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.