Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3966303 44 0 Q7TFA1(NS7B_SARS) RecName: Full=Protein non-structural 7b; Short=ns7b;AltName: Full=Accessory protein 7b;
QUERYSEQ
MNELTLIDFYLCFLAFLLFLVLIMLIIFWFSLEIQDLEEPCTKV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q7TFA1(NS7B_SARS)]

44
region name description
1-44 CHAIN /note="Protein non-structural 7b" /id="PRO_0000283857"
1-1 DISORDER predicted by DISOPRED

No homologue is found in PDB.

Please check [SiteTable] for homologues.