Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
885993 | 39 | 0 | Q7TFA0(NS8A_SARS) | RecName: Full=ORF8a protein;AltName: Full=Accessory protein 8a;AltName: Full=Protein non-structural 8a; Short=ns8a;Flags: Precursor; |
QUERYSEQ |
MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH |
39 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() |
1-15 | SIGNAL | |
![]() ![]() |
16-39 | CHAIN | /note="ORF8a protein" /id="PRO_0000283858" |
![]() ![]() |
1-1 | DISORDER | predicted by DISOPRED |