Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
| PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
| 3703214 | 365 | 12 | Q5W0Z9(ZDH20_HUMAN) | RecName: Full=Palmitoyltransferase ZDHHC20 ; EC=2.3.1.225 ;AltName: Full=Acyltransferase ZDHHC20 ; EC=2.3.1.- ;AltName: Full=DHHC domain-containing cysteine-rich protein 20 ; Short=DHHC20 ;AltName: Full=Zinc finger DHHC domain-containing protein 20 ; |
| QUERYSEQ |
MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCIL KMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMD PEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN |
|||
| 365 |
|
region | name | description |
|
|
1-365 | CHAIN | /note="Palmitoyltransferase ZDHHC20" /id="PRO_0000212906" |
|
|
1-14 | TOPO_DOM | /note="Cytoplasmic" |
|
|
15-35 | TRANSMEM | /note="Helical" |
|
|
36-53 | TOPO_DOM | /note="Lumenal" |
|
|
54-74 | TRANSMEM | /note="Helical" |
|
|
75-169 | TOPO_DOM | /note="Cytoplasmic" |
|
|
170-190 | TRANSMEM | /note="Helical" |
|
|
191-207 | TOPO_DOM | /note="Lumenal" |
|
|
208-231 | TRANSMEM | /note="Helical" |
|
|
232-365 | TOPO_DOM | /note="Cytoplasmic" |
|
|
126-176 | DOMAIN | /note="DHHC" |
|
|
156-156 | ACT_SITE | /note="S-palmitoyl cysteine intermediate" |
|
|
128-128 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:6BMN" |
|
|
131-131 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:6BMN" |
|
|
135-135 | BINDING | /ligand="substrate" |
|
|
140-143 | BINDING | /ligand="substrate" |
|
|
141-141 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:6BMN" |
|
|
142-142 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:6BMN" |
|
|
145-145 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:6BMN" |
|
|
148-148 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:6BMN" |
|
|
155-155 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:6BMN" |
|
|
162-162 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:6BMN" |
|
|
1-365 | DISORDER | predicted by DISOPRED |
MONOMER |
|||||||
| 365 | |||||||
|
|
pdb_id | a1 | identity[%]2 | description | |||
|
|
6bml |
B | 99.7 | ZDH20_HUMAN human DHHC20 palmitoyltransferase | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
|||||||
HETERO |
|||||||
| 365 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
6bmn[2] |
B | ZDH20_HUMAN human DHHC20 palmitoyltransferase[294 aa] | A | 100.0 /100.0 |
7 /7 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
8hf3[1] |
B | GOGA7_HUMAN Golgin subfamily A member 7[124 aa] | A | 40.0 /41.2 |
5 /27 |
ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 |
|
|
8hfc[1] |
B | ERFD_YEAST Ras modification protein ERF4[222 aa] | A | 31.6 /32.2 |
38 /48 |
ERFB_YEAST Palmitoyltransferase ERF2 |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND |
|||||||
| 365 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
6bml[2] |
J |
PAP
|
B | 100.0 /99.7 |
6 /6 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bmm[2] |
G |
DYD
|
A | 100.0 /100.0 |
3 /3 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bmm[1] |
H |
DYD
|
A | 100.0 /100.0 |
2 /2 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bmm[1] |
I |
DYD
|
A | 100.0 /100.0 |
1 /1 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bmm[1] |
J |
DYD
|
A | 100.0 /100.0 |
4 /4 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bmm[1] |
K |
DYD
|
A | 100.0 /100.0 |
2 /2 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bmm[1] |
K |
DYD
|
B | 100.0 /100.0 |
1 /1 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
7khm[2] |
E |
PKZ
|
A | 100.0 /99.7 |
16 /16 |
ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20 |
|
|
7khm[1] |
E |
PKZ
|
B | 100.0 /99.7 |
6 /6 |
ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20 |
|
|
6bms[1] |
I |
POV
|
A | 37.5 /61.8 |
8 /8 |
F1QXD3_DANRE Palmitoyltransferase |
|
|
8hf3[1] |
I |
PX2
|
A | 0.0 /41.2 |
1 /11 |
ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL |
|||||||
| 365 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
6bml[4] |
C |
ZN
|
A | 100.0 /99.7 |
4 /4 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bml[4] |
D |
ZN
|
A | 100.0 /99.7 |
4 /4 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bmm[2] |
C |
ZN
|
A | 100.0 /100.0 |
4 /4 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bmm[2] |
D |
ZN
|
A | 100.0 /100.0 |
5 /5 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bms[2] |
C |
ZN
|
A | 80.0 /61.8 |
5 /5 |
F1QXD3_DANRE Palmitoyltransferase |
|
|
6bms[2] |
D |
ZN
|
A | 100.0 /61.8 |
4 /4 |
F1QXD3_DANRE Palmitoyltransferase |
|
|
7khm[2] |
C |
ZN
|
A | 100.0 /99.7 |
4 /4 |
ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20 |
|
|
7khm[2] |
D |
ZN
|
A | 100.0 /99.7 |
4 /4 |
ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20 |
|
|
8hf3[1] |
C |
ZN
|
A | 100.0 /41.2 |
4 /4 |
ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 |
|
|
8hf3[1] |
D |
ZN
|
A | 100.0 /41.2 |
4 /4 |
ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 |
|
|
8hfc[1] |
D |
ZN
|
A | 100.0 /32.2 |
4 /4 |
ERFB_YEAST Palmitoyltransferase ERF2 |
|
|
8hfc[1] |
E |
ZN
|
A | 100.0 /32.2 |
4 /4 |
ERFB_YEAST Palmitoyltransferase ERF2 |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO |
|||||||
| 365 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
6bml[2] |
B | ZDH20_HUMAN human DHHC20 palmitoyltransferase[294 aa] | A | 100.0 /99.7 |
7 /7 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bmm[2] |
B | ZDH20_HUMAN human DHHC20 palmitoyltransferase[290 aa] | A | 100.0 /100.0 |
2 /2 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
7khm[1] |
B | ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20[287 aa] | A | 100.0 /99.7 |
7 /7 |
ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20 |
|
|
7khm[1] |
A | ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20[290 aa] | B | 100.0 /99.7 |
7 /7 |
ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20 |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT |
|||||||
| 365 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
6bmm[2] |
F |
OLB
|
A | 92.3 /100.0 |
13 /13 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bml[5] |
F |
PO4
|
A | 100.0 /99.7 |
3 /3 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bmm[5] |
E |
PO4
|
A | 100.0 /100.0 |
3 /3 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
7khm[1] |
F |
PO4
|
A | 100.0 /99.7 |
3 /3 |
ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20 |
|
|
6bms[1] |
E |
LMT
|
A | 80.0 /61.8 |
5 /5 |
F1QXD3_DANRE Palmitoyltransferase |
|
|
6bms[3] |
F |
LMT
|
A | 100.0 /61.8 |
4 /4 |
F1QXD3_DANRE Palmitoyltransferase |
|
|
6bms[1] |
Q |
LMT
|
B | 50.0 /61.4 |
2 /2 |
F1QXD3_DANRE Palmitoyltransferase |
|
|
6bml[2] |
E |
PLM
|
A | 100.0 /99.7 |
13 /13 |
ZDH20_HUMAN human DHHC20 palmitoyltransferase |
|
|
6bms[2] |
H |
PLM
|
A | 82.4 /61.8 |
17 /17 |
F1QXD3_DANRE Palmitoyltransferase |
|
|
8hf3[1] |
E |
PLM
|
A | 57.1 /41.2 |
7 /10 |
ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 |
|
|
8hf3[1] |
H |
PLM
|
A | 100.0 /41.2 |
2 /7 |
ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 |
|
|
8hfc[1] |
C |
PLM
|
A | 71.4 /32.2 |
7 /8 |
ERFB_YEAST Palmitoyltransferase ERF2 |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||