Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
883660 365 10 Q5W0Z9(ZDH20_HUMAN) RecName: Full=Palmitoyltransferase ZDHHC20 ; EC=2.3.1.225 ;AltName: Full=Acyltransferase ZDHHC20 ; EC=2.3.1.- ;AltName: Full=DHHC domain-containing cysteine-rich protein 20 ; Short=DHHC20 ;AltName: Full=Zinc finger DHHC domain-containing protein 20 ;
QUERYSEQ 
MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCIL
KMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMD
PEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q5W0Z9(ZDH20_HUMAN)]

365
region name description
1-365 CHAIN /note="Palmitoyltransferase ZDHHC20" /id="PRO_0000212906"
1-14 TOPO_DOM /note="Cytoplasmic"
15-35 TRANSMEM /note="Helical"
36-53 TOPO_DOM /note="Lumenal"
54-74 TRANSMEM /note="Helical"
75-169 TOPO_DOM /note="Cytoplasmic"
170-190 TRANSMEM /note="Helical"
191-207 TOPO_DOM /note="Lumenal"
208-231 TRANSMEM /note="Helical"
232-365 TOPO_DOM /note="Cytoplasmic"
126-176 DOMAIN /note="DHHC"
156-156 ACT_SITE /note="S-palmitoyl cysteine intermediate"
128-128 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:6BMN"
131-131 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:6BMN"
135-135 BINDING /ligand="substrate"
140-143 BINDING /ligand="substrate"
141-141 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:6BMN"
142-142 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:6BMN"
145-145 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:6BMN"
148-148 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:6BMN"
155-155 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:6BMN"
162-162 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:6BMN"
1-365 DISORDER predicted by DISOPRED

MONOMER
365
pdb_id a1 identity[%]2 description
6bml B 99.7 ZDH20_HUMAN human DHHC20 palmitoyltransferase 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6bmn[2] B ZDH20_HUMAN human DHHC20 palmitoyltransferase[294 aa] A 100.0
/100.0		 7
/7		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6bml[2] J PAP
3'-PHOSPHATE-ADENOSINE-5'-DIPHOSPHATE[31 atoms] 		B 100.0
/99.7		 6
/6		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[2] G DYD
(2S,5S)-hexane-2,5-diol[8 atoms] 		A 100.0
/100.0		 3
/3		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[1] H DYD
(2S,5S)-hexane-2,5-diol[8 atoms] 		A 100.0
/100.0		 2
/2		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[1] I DYD
(2S,5S)-hexane-2,5-diol[8 atoms] 		A 100.0
/100.0		 1
/1		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[1] J DYD
(2S,5S)-hexane-2,5-diol[8 atoms] 		A 100.0
/100.0		 4
/4		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[1] K DYD
(2S,5S)-hexane-2,5-diol[8 atoms] 		A 100.0
/100.0		 2
/2		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[1] K DYD
(2S,5S)-hexane-2,5-diol[8 atoms] 		B 100.0
/100.0		 1
/1		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
7khm[2] E PKZ
Palmitoyl-CoA[65 atoms] 		A 100.0
/99.7		 16
/16		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
7khm[1] E PKZ
Palmitoyl-CoA[65 atoms] 		B 100.0
/99.7		 6
/6		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
6bms[1] I POV
(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoylox.. 		A 37.5
/61.8		 8
/8		 F1QXD3_DANRE Palmitoyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6bml[4] C ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 4
/4		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bml[4] D ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 4
/4		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[2] C ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[2] D ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bms[2] C ZN
ZINC ION[1 atoms] 		A 80.0
/61.8		 5
/5		 F1QXD3_DANRE Palmitoyltransferase
6bms[2] D ZN
ZINC ION[1 atoms] 		A 100.0
/61.8		 4
/4		 F1QXD3_DANRE Palmitoyltransferase
7khm[2] C ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 4
/4		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
7khm[2] D ZN
ZINC ION[1 atoms] 		A 100.0
/99.7		 4
/4		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6bml[2] B ZDH20_HUMAN human DHHC20 palmitoyltransferase[294 aa] A 100.0
/99.7		 7
/7		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[2] B ZDH20_HUMAN human DHHC20 palmitoyltransferase[290 aa] A 100.0
/100.0		 2
/2		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
7khm[1] B ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20[287 aa] A 100.0
/99.7		 7
/7		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
7khm[1] A ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20[290 aa] B 100.0
/99.7		 7
/7		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6bmm[2] F OLB
(2S)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate[25 .. 		A 92.3
/100.0		 13
/13		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bml[5] F PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/99.7		 3
/3		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bmm[5] E PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
7khm[1] F PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/99.7		 3
/3		 ZDH20_HUMAN Isoform 4 of Palmitoyltransferase ZDHHC20
6bml[2] E PLM
PALMITIC ACID[18 atoms] 		A 100.0
/99.7		 13
/13		 ZDH20_HUMAN human DHHC20 palmitoyltransferase
6bms[2] H PLM
PALMITIC ACID[18 atoms] 		A 82.4
/61.8		 17
/17		 F1QXD3_DANRE Palmitoyltransferase
6bms[1] E LMT
DODECYL-BETA-D-MALTOSIDE[31 atoms] 		A 80.0
/61.8		 5
/5		 F1QXD3_DANRE Palmitoyltransferase
6bms[3] F LMT
DODECYL-BETA-D-MALTOSIDE[28 atoms] 		A 100.0
/61.8		 4
/4		 F1QXD3_DANRE Palmitoyltransferase
6bms[1] Q LMT
DODECYL-BETA-D-MALTOSIDE[10 atoms] 		B 50.0
/61.4		 2
/2		 F1QXD3_DANRE Palmitoyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.