Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
870754 910 129 Q4KMQ2(ANO6_HUMAN) RecName: Full=Anoctamin-6 ;AltName: Full=Small-conductance calcium-activated nonselective cation channel; Short=SCAN channel;AltName: Full=Transmembrane protein 16F;
QUERYSEQ
MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPND
LKNRSSAFGTLNWFTKVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRDAFFNPATRSRIVYFILSRVKYQVINNVSKFGINRLVNSGIYKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFA
WLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMCPQCDRLCPFWKLNITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARPEYEARCTHVVINEITQEEERIPFTAWGKCI
RITLCASAVFFWILLIIASVIGIIVYRLSVFIVFSAKLPKNINGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGC
LLELTTQLTIIMGGKAIWNNIQEVLLPWIMNLIGRFHRVSGSEKITPRWEQDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRLVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMI
PRLVYYWSFSVPPYGDHTSYTMEGYINNTLSIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIVMEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTKNMGVIAERMIEA
VDNNLRPKSE
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q4KMQ2(ANO6_HUMAN)]

910
region name description
1-910 CHAIN /note="Anoctamin-6" /id="PRO_0000191757"
1-300 TOPO_DOM /note="Cytoplasmic"
301-321 TRANSMEM /note="Helical"
322-375 TOPO_DOM /note="Extracellular"
376-396 TRANSMEM /note="Helical"
397-455 TOPO_DOM /note="Cytoplasmic"
456-476 TRANSMEM /note="Helical"
477-509 TOPO_DOM /note="Extracellular"
510-530 TRANSMEM /note="Helical"
531-551 TOPO_DOM /note="Cytoplasmic"
552-572 TRANSMEM /note="Helical"
573-601 TOPO_DOM /note="Extracellular"
602-621 TRANSMEM /note="Helical"
622-663 TOPO_DOM /note="Cytoplasmic"
664-684 TRANSMEM /note="Helical"
685-705 TRANSMEM /note="Helical"
706-722 TOPO_DOM /note="Cytoplasmic"
723-743 TRANSMEM /note="Helical"
744-836 TOPO_DOM /note="Extracellular"
837-857 TRANSMEM /note="Helical"
858-910 TOPO_DOM /note="Cytoplasmic"
623-623 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108"
666-666 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108"
669-669 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108"
1-910 DISORDER predicted by DISOPRED

MONOMER
910
pdb_id a1 identity[%]2 description
8tal B 93.0 ANO6_MOUSE Anoctamin-6
6qp6 B 93.1 ANO6_MOUSE Anoctamin-6
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
COMPOUND
910 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8sur[1] M VUT
5-chloro-N-(2-chloro-4-nitrophenyl)-2-hydroxybenza..
B 100.0
/93.1
4
/4
ANO6_MOUSE Anoctamin-6
7zk3[2] E JRF
1-Hydroxy-3-(trifluoromethyl)pyrido[1,2-a]benzimid..
A 57.1
/45.9
14
/14
ANO1_MOUSE Anoctamin-1
8sun[1] L JRF
1-Hydroxy-3-(trifluoromethyl)pyrido[1,2-a]benzimid..
B 80.0
/93.0
5
/5
ANO6_MOUSE Anoctamin-6
8sun[8] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 80.0
/93.4
5
/5
ANO6_MOUSE Anoctamin-6
8sun[8] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 33.3
/93.4
3
/3
ANO6_MOUSE Anoctamin-6
8sun[8] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/93.4
3
/3
ANO6_MOUSE Anoctamin-6
8sur[1] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 75.0
/93.4
4
/4
ANO6_MOUSE Anoctamin-6
8sur[1] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/93.4
2
/2
ANO6_MOUSE Anoctamin-6
8sur[1] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/93.4
2
/2
ANO6_MOUSE Anoctamin-6
6qp6[8] E P1O
1,2-DIDECANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE[38 atom..
A 100.0
/93.1
10
/10
ANO6_MOUSE Anoctamin-6
6qp6[6] I P1O
1,2-DIDECANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE[38 atom..
A 100.0
/93.1
1
/1
ANO6_MOUSE Anoctamin-6
5oc9[6] F 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[23 ..
A 42.9
/36.1
7
/7
ANO10_HUMAN Anoctamin-10
5oc9[6] J 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[20 ..
A 40.0
/36.1
5
/9
ANO10_HUMAN Anoctamin-10
5oc9[2] L 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[23 ..
A 40.0
/36.1
10
/10
ANO10_HUMAN Anoctamin-10
5oc9[2] N 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[10 ..
A 37.5
/36.1
8
/8
ANO10_HUMAN Anoctamin-10
5oc9[1] V 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[19 ..
B 40.0
/36.0
5
/12
ANO10_HUMAN Anoctamin-10
6r7x[6] G UMQ
UNDECYL-MALTOSIDE[34 atoms]
A 12.5
/35.0
8
/12
ANO10_HUMAN Anoctamin-10
6r7x[4] H UMQ
UNDECYL-MALTOSIDE[23 atoms]
A 75.0
/35.0
4
/4
ANO10_HUMAN Anoctamin-10
6r7x[2] I UMQ
UNDECYL-MALTOSIDE[34 atoms]
A 30.0
/35.0
10
/10
ANO10_HUMAN Anoctamin-10
6r7x[2] L UMQ
UNDECYL-MALTOSIDE[13 atoms]
A 66.7
/35.0
3
/3
ANO10_HUMAN Anoctamin-10
6r7x[2] M UMQ
UNDECYL-MALTOSIDE[11 atoms]
A 33.3
/35.0
3
/3
ANO10_HUMAN Anoctamin-10
6r7x[2] N UMQ
UNDECYL-MALTOSIDE[10 atoms]
A 0.0
/35.0
2
/2
ANO10_HUMAN Anoctamin-10
6r7x[2] O UMQ
UNDECYL-MALTOSIDE[12 atoms]
A 0.0
/35.0
2
/2
ANO10_HUMAN Anoctamin-10
6r7x[2] V UMQ
UNDECYL-MALTOSIDE[34 atoms]
A 100.0
/35.0
1
/2
ANO10_HUMAN Anoctamin-10
7rwj[13] E PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 25.0
/30.8
8
/13
Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
7rwj[52] J PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 25.0
/30.8
8
/8
Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
7rx2[7] E PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 66.7
/31.7
3
/6
Q4WA18_ASPFU afTMEM16 lipid scramblase
7rx2[10] G PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 16.7
/31.7
6
/6
Q4WA18_ASPFU afTMEM16 lipid scramblase
7rx2[11] I PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 33.3
/31.7
6
/6
Q4WA18_ASPFU afTMEM16 lipid scramblase
7rx3[7] D PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 28.6
/31.4
7
/7
Q4WA18_ASPFU afTMEM16 lipid scramblase
7rx3[4] G PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 0.0
/31.4
6
/6
Q4WA18_ASPFU afTMEM16 lipid scramblase
7rxg[3] F PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 50.0
/31.4
4
/5
Q4WA18_ASPFU afTMEM16 lipid scramblase
7rxg[3] H PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 33.3
/31.4
6
/8
Q4WA18_ASPFU afTMEM16 lipid scramblase
7rxh[1] Q PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 0.0
/31.4
1
/4
Q4WA18_ASPFU afTMEM16 lipid scramblase
7rxh[1] R PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 0.0
/31.4
2
/2
Q4WA18_ASPFU afTMEM16 lipid scramblase
8toi[10] E PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 33.3
/26.5
3
/7
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
8toi[10] I PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 0.0
/26.5
2
/2
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
8toi[8] J PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 0.0
/26.5
2
/6
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
8toi[2] L PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 0.0
/26.5
6
/6
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
8toi[2] M PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 33.3
/26.5
3
/3
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
8toi[2] N PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 33.3
/26.5
3
/3
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
8toi[2] Q PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 33.3
/26.5
12
/12
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
8toi[2] R PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 0.0
/26.5
5
/5
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
8toi[6] S PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 25.0
/26.5
8
/8
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
8toi[2] U PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 0.0
/26.5
2
/2
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
8toi[2] V PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..
A 25.0
/26.5
4
/4
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
6e1o[2] E D12
DODECANE[12 atoms]
A 0.0
/31.1
2
/2
Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
6e1o[2] F D12
DODECANE[12 atoms]
A 33.3
/31.1
3
/6
Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
6e1o[2] G D12
DODECANE[12 atoms]
A 50.0
/31.1
2
/2
Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
6e1o[2] H D12
DODECANE[12 atoms]
A 0.0
/31.1
4
/4
Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
6e1o[2] I D10
DECANE[10 atoms]
A 50.0
/31.1
4
/4
Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
6e1o[2] J 8K6
Octadecane[18 atoms]
A 50.0
/31.1
2
/5
Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
910 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4wis[28] C CA
CALCIUM ION[1 atoms]
A 83.3
/27.5
6
/6
C7Z7K1_NECH7 lipid scramblase
5oc9[16] C CA
CALCIUM ION[1 atoms]
A 80.0
/36.1
5
/5
ANO10_HUMAN Anoctamin-10
5oc9[8] E CA
CALCIUM ION[1 atoms]
A 100.0
/36.1
1
/4
ANO10_HUMAN Anoctamin-10
5oyb[24] C CA
CALCIUM ION[1 atoms]
A 100.0
/45.8
5
/5
ANO1_MOUSE Anoctamin-1
6e0h[22] C CA
CALCIUM ION[1 atoms]
A 100.0
/32.3
2
/4
Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
6p46[41] C CA
CALCIUM ION[1 atoms]
A 100.0
/94.6
3
/3
ANO6_MOUSE Anoctamin-6
6qp6[16] F CA
CALCIUM ION[1 atoms]
A 100.0
/93.1
4
/4
ANO6_MOUSE Anoctamin-6
7zk3[4] F CA
CALCIUM ION[1 atoms]
A 75.0
/45.9
4
/4
ANO1_MOUSE Anoctamin-1
8sun[12] F CA
CALCIUM ION[1 atoms]
A 100.0
/93.4
5
/5
ANO6_MOUSE Anoctamin-6
8toi[38] C CA
CALCIUM ION[1 atoms]
A 85.7
/26.5
7
/7
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
910 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8sur[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/93.1
1
/1
ANO6_MOUSE Anoctamin-6
8sur[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 60.0
/93.1
5
/5
ANO6_MOUSE Anoctamin-6
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
910 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6qpi[2] B ANO6_MOUSE Anoctamin-6[231 aa] A 100.0
/99.1
1
/1
ANO6_MOUSE Anoctamin-6
6p48[4] B ANO6_MOUSE Anoctamin-6[604 aa] A 95.0
/95.7
20
/20
ANO6_MOUSE Anoctamin-6
6p46[2] B ANO6_MOUSE Anoctamin-6[690 aa] A 93.3
/94.6
15
/15
ANO6_MOUSE Anoctamin-6
8bc0[3] A ANO6_MOUSE Anoctamin-6[680 aa] B 100.0
/94.5
12
/12
ANO6_MOUSE Anoctamin-6
6qpc[2] B ANO6_MOUSE Anoctamin-6[577 aa] A 100.0
/94.5
14
/14
ANO6_MOUSE Anoctamin-6
6p47[2] B ANO6_MOUSE Anoctamin-6[725 aa] A 100.0
/94.1
17
/17
ANO6_MOUSE Anoctamin-6
8bc0[1] B ANO6_MOUSE Anoctamin-6[636 aa] A 100.0
/93.8
11
/11
ANO6_MOUSE Anoctamin-6
6qp6[14] B ANO6_MOUSE Anoctamin-6[741 aa] A 100.0
/93.1
17
/17
ANO6_MOUSE Anoctamin-6
8sun[8] B ANO6_MOUSE Anoctamin-6[743 aa] A 100.0
/93.4
13
/13
ANO6_MOUSE Anoctamin-6
8sur[2] B ANO6_MOUSE Anoctamin-6[709 aa] A 100.0
/93.4
14
/14
ANO6_MOUSE Anoctamin-6
6bgi[4] B ANO1_MOUSE Anoctamin-1[510 aa] A 25.0
/49.3
8
/8
ANO1_MOUSE Anoctamin-1
5oyb[14] B ANO1_MOUSE Anoctamin-1[718 aa] A 45.5
/45.8
11
/11
ANO1_MOUSE Anoctamin-1
5oc9[8] B ANO10_HUMAN Anoctamin-10[616 aa] A 33.3
/36.1
6
/31
ANO10_HUMAN Anoctamin-10
6r7z[2] B ANO10_HUMAN Anoctamin-10[614 aa] A 66.7
/35.2
3
/3
ANO10_HUMAN Anoctamin-10
8tok[12] B C7Z7K1_FUSV7 Lipid scramblase nhTMEM16[629 aa] A 42.9
/26.7
7
/54
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
7rwj[4] B Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative[6.. A 0.0
/30.8
3
/61
Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
7rxg[2] B Q4WA18_ASPFU afTMEM16 lipid scramblase[650 aa] A 16.7
/31.4
6
/75
Q4WA18_ASPFU afTMEM16 lipid scramblase
6dz7[6] B Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative[5.. A 0.0
/32.4
1
/40
Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
8tpp[2] B C7Z7K1_FUSV7 Lipid scramblase nhTMEM16[584 aa] A 0.0
/28.1
2
/34
C7Z7K1_FUSV7 Lipid scramblase nhTMEM16
4wis[4] B C7Z7K1_NECH7 lipid scramblase[654 aa] A 28.6
/27.5
7
/68
C7Z7K1_NECH7 lipid scramblase
6qm4[16] B C7Z7K1_NECH7 Predicted protein[654 aa] A 66.7
/26.7
3
/65
C7Z7K1_NECH7 Predicted protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
910 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5oc9[1] I 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[6 a..
A 33.3
/36.1
6
/8
ANO10_HUMAN Anoctamin-10
6r7x[2] F PC1
1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE[47 atoms]
A 33.3
/35.0
15
/15
ANO10_HUMAN Anoctamin-10
6r7x[2] U PC1
1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE[47 atoms]
A 0.0
/35.0
1
/1
ANO10_HUMAN Anoctamin-10
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.