HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

881445

910

103

Q4KMQ2(ANO6_HUMAN)

RecName: Full=Anoctamin-6 ;AltName: Full=Small-conductance calcium-activated nonselective cation channel; Short=SCAN channel;AltName: Full=Transmembrane protein 16F;

QUERYSEQ

MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPND
LKNRSSAFGTLNWFTKVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRDAFFNPATRSRIVYFILSRVKYQVINNVSKFGINRLVNSGIYKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFA
WLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMCPQCDRLCPFWKLNITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARPEYEARCTHVVINEITQEEERIPFTAWGKCI
RITLCASAVFFWILLIIASVIGIIVYRLSVFIVFSAKLPKNINGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGC
LLELTTQLTIIMGGKAIWNNIQEVLLPWIMNLIGRFHRVSGSEKITPRWEQDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRLVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMI
PRLVYYWSFSVPPYGDHTSYTMEGYINNTLSIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIVMEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTKNMGVIAERMIEA
VDNNLRPKSE

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q4KMQ2(ANO6_HUMAN)]

910
	region	name	description
	1-910	CHAIN	/note="Anoctamin-6" /id="PRO_0000191757"
	1-300	TOPO_DOM	/note="Cytoplasmic"
	301-321	TRANSMEM	/note="Helical"
	322-375	TOPO_DOM	/note="Extracellular"
	376-396	TRANSMEM	/note="Helical"
	397-455	TOPO_DOM	/note="Cytoplasmic"
	456-476	TRANSMEM	/note="Helical"
	477-509	TOPO_DOM	/note="Extracellular"
	510-530	TRANSMEM	/note="Helical"
	531-551	TOPO_DOM	/note="Cytoplasmic"
	552-572	TRANSMEM	/note="Helical"
	573-601	TOPO_DOM	/note="Extracellular"
	602-621	TRANSMEM	/note="Helical"
	622-663	TOPO_DOM	/note="Cytoplasmic"
	664-684	TRANSMEM	/note="Helical"
	685-705	TRANSMEM	/note="Helical"
	706-722	TOPO_DOM	/note="Cytoplasmic"
	723-743	TRANSMEM	/note="Helical"
	744-836	TOPO_DOM	/note="Extracellular"
	837-857	TRANSMEM	/note="Helical"
	858-910	TOPO_DOM	/note="Cytoplasmic"
	623-623	BINDING	/ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108"
	666-666	BINDING	/ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108"
	669-669	BINDING	/ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108"
	1-910	DISORDER	predicted by DISOPRED

MONOMER

910

pdb_id a¹ identity[%]² description

8tal B 93.0 ANO6_MOUSE Anoctamin-6

6qp6 A 93.1 ANO6_MOUSE Anoctamin-6

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

COMPOUND

910 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

8sur[7] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 75.0
/93.1 4
/4 ANO6_MOUSE Anoctamin-6

8sur[7] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 0.0
/93.1 2
/2 ANO6_MOUSE Anoctamin-6

8sur[7] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/93.1 2
/2 ANO6_MOUSE Anoctamin-6

6qp6[8] E P1O
1,2-DIDECANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE[38 atom.. A 100.0
/93.1 10
/10 ANO6_MOUSE Anoctamin-6

6qp6[6] I P1O
1,2-DIDECANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE[38 atom.. A 100.0
/93.1 1
/1 ANO6_MOUSE Anoctamin-6

7zk3[2] E JRF
1-Hydroxy-3-(trifluoromethyl)pyrido[1,2-a]benzimid.. A 57.1
/45.9 14
/14 ANO1_MOUSE Anoctamin-1

5oc9[6] F 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[23 .. A 42.9
/36.1 7
/7 ANO10_HUMAN Anoctamin-10

5oc9[6] J 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[20 .. A 40.0
/36.1 5
/9 ANO10_HUMAN Anoctamin-10

5oc9[2] L 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[23 .. A 40.0
/36.1 10
/10 ANO10_HUMAN Anoctamin-10

5oc9[2] N 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[10 .. A 37.5
/36.1 8
/8 ANO10_HUMAN Anoctamin-10

5oc9[1] V 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[19 .. B 40.0
/36.0 5
/12 ANO10_HUMAN Anoctamin-10

6r7x[6] G UMQ
UNDECYL-MALTOSIDE[34 atoms] A 12.5
/35.0 8
/12 ANO10_HUMAN Anoctamin-10

6r7x[4] H UMQ
UNDECYL-MALTOSIDE[23 atoms] A 75.0
/35.0 4
/4 ANO10_HUMAN Anoctamin-10

6r7x[2] I UMQ
UNDECYL-MALTOSIDE[34 atoms] A 30.0
/35.0 10
/10 ANO10_HUMAN Anoctamin-10

6r7x[2] L UMQ
UNDECYL-MALTOSIDE[13 atoms] A 66.7
/35.0 3
/3 ANO10_HUMAN Anoctamin-10

6r7x[2] M UMQ
UNDECYL-MALTOSIDE[11 atoms] A 33.3
/35.0 3
/3 ANO10_HUMAN Anoctamin-10

6r7x[2] N UMQ
UNDECYL-MALTOSIDE[10 atoms] A 0.0
/35.0 2
/2 ANO10_HUMAN Anoctamin-10

6r7x[2] O UMQ
UNDECYL-MALTOSIDE[12 atoms] A 0.0
/35.0 2
/2 ANO10_HUMAN Anoctamin-10

6r7x[2] V UMQ
UNDECYL-MALTOSIDE[34 atoms] A 100.0
/35.0 1
/2 ANO10_HUMAN Anoctamin-10

7rwj[13] E PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro.. A 25.0
/30.8 8
/13 Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative

7rwj[22] J PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro.. A 25.0
/30.8 8
/8 Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative

7rx2[7] E PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro.. A 66.7
/31.7 3
/6 Q4WA18_ASPFU afTMEM16 lipid scramblase

7rx2[10] G PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro.. A 16.7
/31.7 6
/6 Q4WA18_ASPFU afTMEM16 lipid scramblase

7rx2[11] I PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro.. A 33.3
/31.7 6
/6 Q4WA18_ASPFU afTMEM16 lipid scramblase

7rx3[5] D PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro.. A 28.6
/31.4 7
/7 Q4WA18_ASPFU afTMEM16 lipid scramblase

7rx3[4] G PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro.. A 0.0
/31.4 6
/6 Q4WA18_ASPFU afTMEM16 lipid scramblase

7rxg[3] F PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro.. A 50.0
/31.4 4
/5 Q4WA18_ASPFU afTMEM16 lipid scramblase

7rxg[3] H PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro.. A 33.3
/31.4 6
/8 Q4WA18_ASPFU afTMEM16 lipid scramblase

7rxh[1] Q PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro.. A 0.0
/31.4 1
/4 Q4WA18_ASPFU afTMEM16 lipid scramblase

7rxh[1] R PGW
(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro.. A 0.0
/31.4 2
/2 Q4WA18_ASPFU afTMEM16 lipid scramblase

6e1o[2] E D12
DODECANE[12 atoms] A 0.0
/31.1 2
/2 Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative

6e1o[2] F D12
DODECANE[12 atoms] A 33.3
/31.1 3
/6 Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative

6e1o[2] G D12
DODECANE[12 atoms] A 50.0
/31.1 2
/2 Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative

6e1o[2] H D12
DODECANE[12 atoms] A 0.0
/31.1 4
/4 Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative

6e1o[2] I D10
DECANE[10 atoms] A 50.0
/31.1 4
/4 Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative

6e1o[2] J 8K6
Octadecane[18 atoms] A 50.0
/31.1 2
/5 Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

910 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

4wis[28] C CA
CALCIUM ION[1 atoms] A 83.3
/27.5 6
/6 C7Z7K1_NECH7 lipid scramblase

5oc9[16] C CA
CALCIUM ION[1 atoms] A 80.0
/36.1 5
/5 ANO10_HUMAN Anoctamin-10

5oc9[8] E CA
CALCIUM ION[1 atoms] A 100.0
/36.1 1
/4 ANO10_HUMAN Anoctamin-10

5oyb[22] C CA
CALCIUM ION[1 atoms] A 100.0
/45.8 5
/5 ANO1_MOUSE Anoctamin-1

6e0h[22] C CA
CALCIUM ION[1 atoms] A 100.0
/32.3 2
/4 Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative

6p46[38] C CA
CALCIUM ION[1 atoms] A 100.0
/94.6 3
/3 ANO6_MOUSE Anoctamin-6

6qp6[14] F CA
CALCIUM ION[1 atoms] A 100.0
/93.1 4
/4 ANO6_MOUSE Anoctamin-6

7zk3[2] F CA
CALCIUM ION[1 atoms] A 75.0
/45.9 4
/4 ANO1_MOUSE Anoctamin-1

8sur[12] J CA
CALCIUM ION[1 atoms] A 100.0
/93.1 5
/5 ANO6_MOUSE Anoctamin-6

8sur[2] K CA
CALCIUM ION[1 atoms] A 100.0
/93.1 4
/4 ANO6_MOUSE Anoctamin-6

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

OTHERPOLY

910 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

8sur[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 60.0
/93.0 5
/5 ANO6_MOUSE Anoctamin-6

8sur[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/93.0 1
/1 ANO6_MOUSE Anoctamin-6

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

910 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6qpi[2] B ANO6_MOUSE Anoctamin-6[231 aa] A 100.0
/99.1 1
/1 ANO6_MOUSE Anoctamin-6

6p48[4] B ANO6_MOUSE Anoctamin-6[604 aa] A 95.0
/95.7 20
/20 ANO6_MOUSE Anoctamin-6

6p46[2] B ANO6_MOUSE Anoctamin-6[690 aa] A 93.3
/94.6 15
/15 ANO6_MOUSE Anoctamin-6

8bc0[3] A ANO6_MOUSE Anoctamin-6[680 aa] B 100.0
/94.5 12
/12 ANO6_MOUSE Anoctamin-6

6qpc[2] B ANO6_MOUSE Anoctamin-6[577 aa] A 100.0
/94.5 14
/14 ANO6_MOUSE Anoctamin-6

6p47[2] B ANO6_MOUSE Anoctamin-6[725 aa] A 100.0
/94.1 17
/17 ANO6_MOUSE Anoctamin-6

8bc0[1] B ANO6_MOUSE Anoctamin-6[636 aa] A 100.0
/93.8 11
/11 ANO6_MOUSE Anoctamin-6

6qp6[14] B ANO6_MOUSE Anoctamin-6[741 aa] A 100.0
/93.1 17
/17 ANO6_MOUSE Anoctamin-6

8tag[6] B ANO6_MOUSE Anoctamin-6[743 aa] A 100.0
/93.2 13
/13 ANO6_MOUSE Anoctamin-6

6bgi[4] B ANO1_MOUSE Anoctamin-1[510 aa] A 25.0
/49.3 8
/8 ANO1_MOUSE Anoctamin-1

5oyb[12] B ANO1_MOUSE Anoctamin-1[718 aa] A 45.5
/45.8 11
/11 ANO1_MOUSE Anoctamin-1

5oc9[8] B ANO10_HUMAN Anoctamin-10[616 aa] A 33.3
/36.1 6
/31 ANO10_HUMAN Anoctamin-10

6r7z[2] B ANO10_HUMAN Anoctamin-10[614 aa] A 66.7
/35.2 3
/3 ANO10_HUMAN Anoctamin-10

7rwj[4] B Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative[6.. A 0.0
/30.8 3
/61 Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative

7rxg[2] B Q4WA18_ASPFU afTMEM16 lipid scramblase[650 aa] A 16.7
/31.4 6
/75 Q4WA18_ASPFU afTMEM16 lipid scramblase

6dz7[6] B Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative[5.. A 0.0
/32.4 1
/40 Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative

4wis[4] B C7Z7K1_NECH7 lipid scramblase[654 aa] A 28.6
/27.5 7
/68 C7Z7K1_NECH7 lipid scramblase

6qm4[12] B C7Z7K1_NECH7 Predicted protein[654 aa] A 66.7
/26.7 3
/65 C7Z7K1_NECH7 Predicted protein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

910 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5oc9[1] I 79M
(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[6 a.. A 33.3
/36.1 6
/8 ANO10_HUMAN Anoctamin-10

6r7x[2] F PC1
1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE[47 atoms] A 33.3
/35.0 15
/15 ANO10_HUMAN Anoctamin-10

6r7x[2] U PC1
1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE[47 atoms] A 0.0
/35.0 1
/1 ANO10_HUMAN Anoctamin-10

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
910
	pdb_id	a¹	identity[%]²	description
	8tal	B	93.0	ANO6_MOUSE Anoctamin-6
	6qp6	A	93.1	ANO6_MOUSE Anoctamin-6
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

COMPOUND
910	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	8sur[7]	E	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	75.0 /93.1	4 /4	ANO6_MOUSE Anoctamin-6
	8sur[7]	F	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	0.0 /93.1	2 /2	ANO6_MOUSE Anoctamin-6
	8sur[7]	H	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /93.1	2 /2	ANO6_MOUSE Anoctamin-6
	6qp6[8]	E	P1O 1,2-DIDECANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE[38 atom..	A	100.0 /93.1	10 /10	ANO6_MOUSE Anoctamin-6
	6qp6[6]	I	P1O 1,2-DIDECANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE[38 atom..	A	100.0 /93.1	1 /1	ANO6_MOUSE Anoctamin-6
	7zk3[2]	E	JRF 1-Hydroxy-3-(trifluoromethyl)pyrido[1,2-a]benzimid..	A	57.1 /45.9	14 /14	ANO1_MOUSE Anoctamin-1
	5oc9[6]	F	79M (2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[23 ..	A	42.9 /36.1	7 /7	ANO10_HUMAN Anoctamin-10
	5oc9[6]	J	79M (2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[20 ..	A	40.0 /36.1	5 /9	ANO10_HUMAN Anoctamin-10
	5oc9[2]	L	79M (2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[23 ..	A	40.0 /36.1	10 /10	ANO10_HUMAN Anoctamin-10
	5oc9[2]	N	79M (2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[10 ..	A	37.5 /36.1	8 /8	ANO10_HUMAN Anoctamin-10
	5oc9[1]	V	79M (2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[19 ..	B	40.0 /36.0	5 /12	ANO10_HUMAN Anoctamin-10
	6r7x[6]	G	UMQ UNDECYL-MALTOSIDE[34 atoms]	A	12.5 /35.0	8 /12	ANO10_HUMAN Anoctamin-10
	6r7x[4]	H	UMQ UNDECYL-MALTOSIDE[23 atoms]	A	75.0 /35.0	4 /4	ANO10_HUMAN Anoctamin-10
	6r7x[2]	I	UMQ UNDECYL-MALTOSIDE[34 atoms]	A	30.0 /35.0	10 /10	ANO10_HUMAN Anoctamin-10
	6r7x[2]	L	UMQ UNDECYL-MALTOSIDE[13 atoms]	A	66.7 /35.0	3 /3	ANO10_HUMAN Anoctamin-10
	6r7x[2]	M	UMQ UNDECYL-MALTOSIDE[11 atoms]	A	33.3 /35.0	3 /3	ANO10_HUMAN Anoctamin-10
	6r7x[2]	N	UMQ UNDECYL-MALTOSIDE[10 atoms]	A	0.0 /35.0	2 /2	ANO10_HUMAN Anoctamin-10
	6r7x[2]	O	UMQ UNDECYL-MALTOSIDE[12 atoms]	A	0.0 /35.0	2 /2	ANO10_HUMAN Anoctamin-10
	6r7x[2]	V	UMQ UNDECYL-MALTOSIDE[34 atoms]	A	100.0 /35.0	1 /2	ANO10_HUMAN Anoctamin-10
	7rwj[13]	E	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..	A	25.0 /30.8	8 /13	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
	7rwj[22]	J	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..	A	25.0 /30.8	8 /8	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
	7rx2[7]	E	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..	A	66.7 /31.7	3 /6	Q4WA18_ASPFU afTMEM16 lipid scramblase
	7rx2[10]	G	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..	A	16.7 /31.7	6 /6	Q4WA18_ASPFU afTMEM16 lipid scramblase
	7rx2[11]	I	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..	A	33.3 /31.7	6 /6	Q4WA18_ASPFU afTMEM16 lipid scramblase
	7rx3[5]	D	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..	A	28.6 /31.4	7 /7	Q4WA18_ASPFU afTMEM16 lipid scramblase
	7rx3[4]	G	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..	A	0.0 /31.4	6 /6	Q4WA18_ASPFU afTMEM16 lipid scramblase
	7rxg[3]	F	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..	A	50.0 /31.4	4 /5	Q4WA18_ASPFU afTMEM16 lipid scramblase
	7rxg[3]	H	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..	A	33.3 /31.4	6 /8	Q4WA18_ASPFU afTMEM16 lipid scramblase
	7rxh[1]	Q	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..	A	0.0 /31.4	1 /4	Q4WA18_ASPFU afTMEM16 lipid scramblase
	7rxh[1]	R	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydro..	A	0.0 /31.4	2 /2	Q4WA18_ASPFU afTMEM16 lipid scramblase
	6e1o[2]	E	D12 DODECANE[12 atoms]	A	0.0 /31.1	2 /2	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
	6e1o[2]	F	D12 DODECANE[12 atoms]	A	33.3 /31.1	3 /6	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
	6e1o[2]	G	D12 DODECANE[12 atoms]	A	50.0 /31.1	2 /2	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
	6e1o[2]	H	D12 DODECANE[12 atoms]	A	0.0 /31.1	4 /4	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
	6e1o[2]	I	D10 DECANE[10 atoms]	A	50.0 /31.1	4 /4	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
	6e1o[2]	J	8K6 Octadecane[18 atoms]	A	50.0 /31.1	2 /5	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
910	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	4wis[28]	C	CA CALCIUM ION[1 atoms]	A	83.3 /27.5	6 /6	C7Z7K1_NECH7 lipid scramblase
	5oc9[16]	C	CA CALCIUM ION[1 atoms]	A	80.0 /36.1	5 /5	ANO10_HUMAN Anoctamin-10
	5oc9[8]	E	CA CALCIUM ION[1 atoms]	A	100.0 /36.1	1 /4	ANO10_HUMAN Anoctamin-10
	5oyb[22]	C	CA CALCIUM ION[1 atoms]	A	100.0 /45.8	5 /5	ANO1_MOUSE Anoctamin-1
	6e0h[22]	C	CA CALCIUM ION[1 atoms]	A	100.0 /32.3	2 /4	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
	6p46[38]	C	CA CALCIUM ION[1 atoms]	A	100.0 /94.6	3 /3	ANO6_MOUSE Anoctamin-6
	6qp6[14]	F	CA CALCIUM ION[1 atoms]	A	100.0 /93.1	4 /4	ANO6_MOUSE Anoctamin-6
	7zk3[2]	F	CA CALCIUM ION[1 atoms]	A	75.0 /45.9	4 /4	ANO1_MOUSE Anoctamin-1
	8sur[12]	J	CA CALCIUM ION[1 atoms]	A	100.0 /93.1	5 /5	ANO6_MOUSE Anoctamin-6
	8sur[2]	K	CA CALCIUM ION[1 atoms]	A	100.0 /93.1	4 /4	ANO6_MOUSE Anoctamin-6
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
910	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	8sur[1]	C	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	B	60.0 /93.0	5 /5	ANO6_MOUSE Anoctamin-6
	8sur[1]	D	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	B	100.0 /93.0	1 /1	ANO6_MOUSE Anoctamin-6
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
910	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6qpi[2]	B	ANO6_MOUSE Anoctamin-6[231 aa]	A	100.0 /99.1	1 /1	ANO6_MOUSE Anoctamin-6
	6p48[4]	B	ANO6_MOUSE Anoctamin-6[604 aa]	A	95.0 /95.7	20 /20	ANO6_MOUSE Anoctamin-6
	6p46[2]	B	ANO6_MOUSE Anoctamin-6[690 aa]	A	93.3 /94.6	15 /15	ANO6_MOUSE Anoctamin-6
	8bc0[3]	A	ANO6_MOUSE Anoctamin-6[680 aa]	B	100.0 /94.5	12 /12	ANO6_MOUSE Anoctamin-6
	6qpc[2]	B	ANO6_MOUSE Anoctamin-6[577 aa]	A	100.0 /94.5	14 /14	ANO6_MOUSE Anoctamin-6
	6p47[2]	B	ANO6_MOUSE Anoctamin-6[725 aa]	A	100.0 /94.1	17 /17	ANO6_MOUSE Anoctamin-6
	8bc0[1]	B	ANO6_MOUSE Anoctamin-6[636 aa]	A	100.0 /93.8	11 /11	ANO6_MOUSE Anoctamin-6
	6qp6[14]	B	ANO6_MOUSE Anoctamin-6[741 aa]	A	100.0 /93.1	17 /17	ANO6_MOUSE Anoctamin-6
	8tag[6]	B	ANO6_MOUSE Anoctamin-6[743 aa]	A	100.0 /93.2	13 /13	ANO6_MOUSE Anoctamin-6
	6bgi[4]	B	ANO1_MOUSE Anoctamin-1[510 aa]	A	25.0 /49.3	8 /8	ANO1_MOUSE Anoctamin-1
	5oyb[12]	B	ANO1_MOUSE Anoctamin-1[718 aa]	A	45.5 /45.8	11 /11	ANO1_MOUSE Anoctamin-1
	5oc9[8]	B	ANO10_HUMAN Anoctamin-10[616 aa]	A	33.3 /36.1	6 /31	ANO10_HUMAN Anoctamin-10
	6r7z[2]	B	ANO10_HUMAN Anoctamin-10[614 aa]	A	66.7 /35.2	3 /3	ANO10_HUMAN Anoctamin-10
	7rwj[4]	B	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative[6..	A	0.0 /30.8	3 /61	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
	7rxg[2]	B	Q4WA18_ASPFU afTMEM16 lipid scramblase[650 aa]	A	16.7 /31.4	6 /75	Q4WA18_ASPFU afTMEM16 lipid scramblase
	6dz7[6]	B	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative[5..	A	0.0 /32.4	1 /40	Q4WA18_ASPFU Plasma membrane channel protein (Aqy1), putative
	4wis[4]	B	C7Z7K1_NECH7 lipid scramblase[654 aa]	A	28.6 /27.5	7 /68	C7Z7K1_NECH7 lipid scramblase
	6qm4[12]	B	C7Z7K1_NECH7 Predicted protein[654 aa]	A	66.7 /26.7	3 /65	C7Z7K1_NECH7 Predicted protein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
910	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5oc9[1]	I	79M (2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate[6 a..	A	33.3 /36.1	6 /8	ANO10_HUMAN Anoctamin-10
	6r7x[2]	F	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE[47 atoms]	A	33.3 /35.0	15 /15	ANO10_HUMAN Anoctamin-10
	6r7x[2]	U	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE[47 atoms]	A	0.0 /35.0	1 /1	ANO10_HUMAN Anoctamin-10
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [Q4KMQ2(ANO6_HUMAN)]