Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
| PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
| 377539 | 826 | 197 | Q16665(HIF1A_HUMAN) | RecName: Full=Hypoxia-inducible factor 1-alpha ; Short=HIF-1-alpha ; Short=HIF1-alpha ;AltName: Full=ARNT-interacting protein;AltName: Full=Basic-helix-loop-helix-PAS protein MOP1 ;AltName: Full=Class E basic helix-loop-helix protein 78; Short=bHLHe78;AltName: Full=Member of PAS protein 1 ;AltName: Full=PAS domain-containing protein 8; |
| QUERYSEQ |
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTH RNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAM SPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSL SWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN |
|||
| 826 |
|
region | name | description |
|
|
1-826 | CHAIN | /note="Hypoxia-inducible factor 1-alpha" /id="PRO_0000127220" |
|
|
17-70 | DOMAIN | /note="bHLH" |
|
|
85-158 | DOMAIN | /note="PAS 1" |
|
|
228-298 | DOMAIN | /note="PAS 2" |
|
|
302-345 | DOMAIN | /note="PAC" |
|
|
1-401 | REGION | /note="Interaction with TSGA10" |
|
|
1-30 | REGION | /note="Disordered" |
|
|
21-30 | REGION | /note="DNA-binding" |
|
|
170-191 | REGION | /note="Required for heterodimer formation with ARNT" |
|
|
380-417 | REGION | /note="N-terminal VHL recognition site" |
|
|
401-603 | REGION | /note="ODD" |
|
|
494-520 | REGION | /note="Disordered" |
|
|
531-575 | REGION | /note="NTAD" ECO:0000303|PubMed:9235919" |
|
|
556-572 | REGION | /note="C-terminal VHL recognition site" |
|
|
576-785 | REGION | /note="ID" |
|
|
642-688 | REGION | /note="Disordered" |
|
|
786-826 | REGION | /note="CTAD" ECO:0000303|PubMed:9235919" |
|
|
8-30 | COMPBIAS | /note="Basic and acidic residues" |
|
|
494-517 | COMPBIAS | /note="Polar residues" |
|
|
652-669 | COMPBIAS | /note="Polar residues" |
|
|
1-826 | DISORDER | predicted by DISOPRED |
MONOMER |
|||||||
| 826 | |||||||
|
|
pdb_id | a1 | identity[%]2 | description | |||
|
|
9ofu |
A | 100.0 | HIF1A_HUMAN Hypoxia-inducible factor 1-alpha | |||
|
|
1l8c |
B | 100.0 | HIF1A_HUMAN Hypoxia-inducible factor 1 alpha | |||
|
|
1wa9 |
A | 30.1 | PER_DROME PERIOD CIRCADIAN PROTEIN | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
|||||||
HETERO |
|||||||
| 826 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
1h2l[2] |
A | Q969Q7 FACTOR INHIBITING HIF1[332 aa] | B | 100.0 /100.0 |
18 /18 |
HIFA_HUMAN HYPOXIA-INDUCIBLE FACTOR 1 ALPHA |
|
|
1h2l[2] |
A | Q969Q7 FACTOR INHIBITING HIF1[332 aa] | B | 100.0 /100.0 |
1 /1 |
HIFA_HUMAN HYPOXIA-INDUCIBLE FACTOR 1 ALPHA |
|
|
1h2m[2] |
A | Q969Q7 FACTOR INHIBITING HIF1[332 aa] | B | 100.0 /100.0 |
18 /18 |
HIFA_HUMAN HYPOXIA-INDUCIBLE FACTOR 1 ALPHA |
|
|
1h2m[2] |
A | Q969Q7 FACTOR INHIBITING HIF1[332 aa] | B | 100.0 /100.0 |
1 /1 |
HIFA_HUMAN HYPOXIA-INDUCIBLE FACTOR 1 ALPHA |
|
|
1l3e[4] |
B | EP300_HUMAN p300 protein[101 aa] | A | 100.0 /100.0 |
27 /27 |
HIF1A_HUMAN hypoxia inducible factor-1 alpha subunit |
|
|
4zp4[15] |
A | ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[261.. | B | 71.9 /71.2 |
64 /66 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
7xhv[2] |
A | ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[177.. | B | 28.9 /29.1 |
38 /47 |
NPAS4_MOUSE Neuronal PAS domain-containing protein 4 |
|
|
9of0[4] |
B | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[268.. | A | 74.5 /71.7 |
55 /56 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
9of2[1] |
D | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[256.. | E | 100.0 /71.3 |
2 /2 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
9ofu[1] |
B | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[229.. | A | 100.0 /100.0 |
63 /63 |
HIF1A_HUMAN Hypoxia-inducible factor 1-alpha |
|
|
9ofu[1] |
B | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[229.. | C | 100.0 /100.0 |
5 /5 |
HIF1A_HUMAN Hypoxia-inducible factor 1-alpha |
|
|
4zpr[1] |
A | ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[235.. | B | 100.0 /99.3 |
52 /52 |
HIF1A_MOUSE Hypoxia-inducible factor 1-alpha |
|
|
2a24[1] |
B | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[108.. | A | 76.9 /75.5 |
26 /26 |
EPAS1_HUMAN Endothelial PAS domain protein 1 |
|
|
3f1n[22] |
B | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[112.. | A | 83.3 /76.7 |
18 /18 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
4h6j[1] |
B | ARNT_HUMAN ARYL HYDROCARBON NUCLEAR TRANSLOCATOR[111 aa] | A | 93.3 /99.1 |
15 /15 |
HIF1A_HUMAN HYPOXIA INDUCIBLE FACTOR 1-ALPHA |
|
|
5tbm[5] |
B | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[110.. | A | 90.9 /76.2 |
11 /11 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
7vni[2] |
B | ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[104.. | A | 36.4 /29.5 |
11 /11 |
O61543_DROME Ahr homolog spineless |
|
|
8vhg[1] |
B | BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1[226 aa].. | A | 68.2 /72.5 |
44 /45 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
7v7l[2] |
A | ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[280.. | B | 59.2 /60.8 |
76 /76 |
HIF3A_MOUSE Hypoxia-inducible factor 3-alpha |
|
|
5sy5[4] |
A | ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[278.. | B | 48.6 /45.9 |
72 /83 |
NPAS1_MOUSE Neuronal PAS domain-containing protein 1 |
|
|
5sy5[2] |
E | ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[279.. | B | 33.3 /45.9 |
3 /3 |
NPAS1_MOUSE Neuronal PAS domain-containing protein 1 |
|
|
5v0l[1] |
A | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[176.. | B | 44.4 /39.2 |
36 /44 |
AHR_MOUSE Aryl hydrocarbon receptor |
|
|
5nj8[1] |
B | ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[174.. | A | 45.2 /38.5 |
31 /43 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
5nj8[1] |
D | ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[134.. | C | 41.9 /36.4 |
31 /35 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
4f3l[1] |
B | CLOCK_MOUSE Circadian locomoter output cycles protein kaput[31.. | A | 36.8 /34.3 |
76 /84 |
Q6F6D6_MOUSE BMAL1b |
|
|
8osk[2] |
K | CLOCK_MOUSE Circadian locomoter output cycles protein kaput[31.. | L | 16.7 /35.1 |
12 /12 |
BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1 |
|
|
5y7y[1] |
B | ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator[263.. | A | 38.9 /34.0 |
36 /63 |
AHRR_HUMAN Aryl hydrocarbon receptor repressor |
|
|
8h77[1] |
F | AIP_MOUSE AH receptor-interacting protein[310 aa] | E | 0.0 /33.3 |
2 /9 |
AHR_MOUSE Aryl hydrocarbon receptor |
|
|
4zp4[16] |
B | EPAS1_MOUSE Endothelial PAS domain-containing protein 1[295 aa.. | A | 37.7 /32.4 |
53 /58 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
9of0[3] |
A | EPAS1_HUMAN Endothelial PAS domain-containing protein 1[314 aa.. | B | 33.9 /31.6 |
56 /61 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
9of2[1] |
E | EPAS1_HUMAN Endothelial PAS domain-containing protein 1[300 aa.. | D | 0.0 /33.1 |
1 /2 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
4lpz[4] |
C | Transforming acidic coiled-coil-containing protein.. | A | 33.3 /33.3 |
6 /6 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
9ofu[2] |
A | HIF1A_HUMAN Hypoxia-inducible factor 1-alpha[302 aa] | B | 29.4 /31.6 |
17 /57 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
7xi3[2] |
B | A1L327_MOUSE Neuronal PAS domain protein 4[314 aa] | A | 29.8 /31.7 |
47 /53 |
Aryl hydrocarbon receptor nuclear translocator 2 |
|
|
4pky[2] |
B | TACC3_MOUSE Transforming acidic coiled-coil-containing protein.. | A | 28.6 /32.6 |
14 /14 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
4pky[2] |
C | TACC3_MOUSE Transforming acidic coiled-coil-containing protein.. | A | 40.0 /32.6 |
5 /6 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
5y7y[1] |
A | AHRR_HUMAN Aryl hydrocarbon receptor repressor[201 aa] | B | 34.0 /32.5 |
50 /56 |
ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator |
|
|
8osk[1] |
H | H2B1J_HUMAN Histone H2B type 1-J[94 aa] | K | 0.0 /32.4 |
1 /1 |
CLOCK_MOUSE Circadian locomoter output cycles protein kaput |
|
|
7zub[6] |
A | HS90B_HUMAN Heat shock protein HSP 90-beta[624 aa] | D | 30.0 /32.1 |
20 /21 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
7zub[2] |
C | AIP_HUMAN AH receptor-interacting protein[304 aa] | D | 0.0 /32.1 |
2 /18 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
8xs6[6] |
A | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[289.. | B | 39.4 /32.1 |
66 /82 |
I3LF82_PIG Aryl hydrocarbon receptor |
|
|
4f3l[1] |
A | Q6F6D6_MOUSE BMAL1b[302 aa] | B | 32.9 /31.5 |
85 /88 |
CLOCK_MOUSE Circadian locomoter output cycles protein kaput |
|
|
8osk[2] |
L | BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1[285 aa].. | K | 30.8 /32.4 |
13 /13 |
CLOCK_MOUSE Circadian locomoter output cycles protein kaput |
|
|
8osk[2] |
E | H31_HUMAN Histone H3.1[94 aa] | K | 0.0 /32.4 |
2 /2 |
CLOCK_MOUSE Circadian locomoter output cycles protein kaput |
|
|
7v7l[2] |
B | HIF3A_MOUSE Hypoxia-inducible factor 3-alpha[299 aa] | A | 34.8 /31.4 |
69 /75 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
2a24[1] |
A | EPAS1_HUMAN Endothelial PAS domain protein 1[107 aa] | B | 30.0 /31.6 |
20 /25 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
3f1n[22] |
A | EPAS1_HUMAN Endothelial PAS domain-containing protein 1[108 aa.. | B | 38.9 /31.6 |
18 /21 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
5tbm[2] |
A | EPAS1_HUMAN Endothelial PAS domain-containing protein 1[106 aa.. | B | 20.0 /31.6 |
10 /10 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
6czw[3] |
A | EPAS1_HUMAN Endothelial PAS domain-containing protein 1[109 aa.. | B | 30.0 /31.6 |
10 /10 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
4h6j[1] |
A | HIF1A_HUMAN HYPOXIA INDUCIBLE FACTOR 1-ALPHA[106 aa] | B | 37.5 /31.6 |
16 /18 |
ARNT_HUMAN ARYL HYDROCARBON NUCLEAR TRANSLOCATOR |
|
|
7vni[2] |
A | O61543_DROME Ahr homolog spineless[110 aa] | B | 36.4 /31.6 |
11 /11 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
5nj8[1] |
A | AHR_HUMAN Aryl hydrocarbon receptor[176 aa] | B | 24.3 /31.6 |
37 /41 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
5sy5[3] |
B | NPAS1_MOUSE Neuronal PAS domain-containing protein 1[278 aa] | A | 32.4 /31.4 |
74 /80 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
5sy5[1] |
D | NPAS1_MOUSE Neuronal PAS domain-containing protein 1[283 aa] | A | 44.4 /31.4 |
9 /11 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
5sy5[1] |
B | NPAS1_MOUSE Neuronal PAS domain-containing protein 1[278 aa] | E | 40.0 /31.5 |
5 /5 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
8xs6[6] |
B | I3LF82_PIG Aryl hydrocarbon receptor[329 aa] | A | 31.4 /31.5 |
70 /76 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
7xhv[1] |
B | NPAS4_MOUSE Neuronal PAS domain-containing protein 4[192 aa] | A | 20.0 /31.2 |
35 /41 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
5v0l[1] |
B | AHR_MOUSE Aryl hydrocarbon receptor[166 aa] | A | 30.4 /30.8 |
23 /34 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
4zpr[1] |
B | HIF1A_MOUSE Hypoxia-inducible factor 1-alpha[279 aa] | A | 32.5 /30.5 |
40 /51 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
5sy7[1] |
B | NPAS3_MOUSE Neuronal PAS domain-containing protein 3[276 aa] | A | 32.1 /29.2 |
53 /76 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
7xi3[1] |
A | Aryl hydrocarbon receptor nuclear translocator 2[2.. | B | 29.3 /27.4 |
58 /61 |
A1L327_MOUSE Neuronal PAS domain protein 4 |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE |
|||||||
| 826 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
9ofu[1] |
E | 52-nt Hypoxia Response Element (Forward) | A | 100.0 /100.0 |
5 /5 |
HIF1A_HUMAN Hypoxia-inducible factor 1-alpha |
|
|
9ofu[1] |
E | 52-nt Hypoxia Response Element (Forward) | C | 100.0 /100.0 |
6 /6 |
HIF1A_HUMAN Hypoxia-inducible factor 1-alpha |
|
|
9ofu[1] |
F | 52-nt Hypoxia Response Element (Reverse) | A | 100.0 /100.0 |
8 /8 |
HIF1A_HUMAN Hypoxia-inducible factor 1-alpha |
|
|
9ofu[1] |
F | 52-nt Hypoxia Response Element (Reverse) | C | 100.0 /100.0 |
4 /4 |
HIF1A_HUMAN Hypoxia-inducible factor 1-alpha |
|
|
8vhg[1] |
C | Reverse strand DNA containing HRE motif | A | 100.0 /72.5 |
5 /5 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
5v0l[1] |
C | DNA (5'-D(P*GP*GP*AP*TP*TP*GP*CP*GP*TP*GP*AP*GP*AP.. | A | 25.0 /30.8 |
8 /8 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
5v0l[1] |
C | DNA (5'-D(P*GP*GP*AP*TP*TP*GP*CP*GP*TP*GP*AP*GP*AP.. | B | 0.0 /39.2 |
1 /4 |
AHR_MOUSE Aryl hydrocarbon receptor |
|
|
5v0l[1] |
D | DNA (5'-D(P*AP*GP*TP*TP*CP*TP*CP*AP*CP*GP*CP*AP*AP.. | A | 100.0 /30.8 |
1 /1 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
5v0l[1] |
D | DNA (5'-D(P*AP*GP*TP*TP*CP*TP*CP*AP*CP*GP*CP*AP*AP.. | B | 100.0 /39.2 |
1 /2 |
AHR_MOUSE Aryl hydrocarbon receptor |
|
|
8vhg[1] |
D | Forward strand DNA containing HRE motif | A | 100.0 /72.5 |
1 /1 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
8vhg[1] |
D | Forward strand DNA containing HRE motif | B | 50.0 /36.6 |
2 /3 |
BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1 |
|
|
5nj8[2] |
E | DNA (5'-D(*GP*GP*TP*CP*AP*CP*GP*CP*AP*AP*CP*C)-3').. | A | 66.7 /38.5 |
3 /7 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
5nj8[1] |
E | DNA (5'-D(*GP*GP*TP*CP*AP*CP*GP*CP*AP*AP*CP*C)-3').. | B | 25.0 /31.6 |
4 /4 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
5nj8[1] |
F | DNA (5'-D(*GP*GP*TP*TP*GP*CP*GP*TP*GP*AP*CP*C)-3').. | B | 36.4 /31.6 |
11 /11 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
5nj8[1] |
H | DNA (5'-D(*GP*GP*TP*TP*GP*CP*GP*TP*GP*AP*CP*C)-3').. | C | 25.0 /36.4 |
4 /4 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
8osk[1] |
J | DNA (124-MER) | L | 50.0 /35.1 |
4 /4 |
BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1 |
|
|
8osl[1] |
J | DNA (147-MER) | K | 0.0 /31.8 |
1 /1 |
CLOCK_MOUSE Circadian locomoter output cycles protein kaput |
|
|
8osl[1] |
J | DNA (147-MER) | L | 42.9 /35.1 |
7 /7 |
BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1 |
|
|
9of2[1] |
A | 51-nt Hypoxia Response Element (Forward) | C | 100.0 /71.9 |
2 /2 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
9of2[1] |
A | 51-nt Hypoxia Response Element (Forward) | D | 75.0 /33.1 |
4 /7 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
9of2[1] |
A | 51-nt Hypoxia Response Element (Forward) | E | 100.0 /71.3 |
3 /4 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
9of2[1] |
A | 51-nt Hypoxia Response Element (Forward) | F | 100.0 /33.2 |
1 /2 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
9of2[1] |
B | 51-nt Hypoxia Response Element (Reverse) | C | 83.3 /71.9 |
6 /6 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
9of2[1] |
B | 51-nt Hypoxia Response Element (Reverse) | D | 100.0 /33.1 |
1 /4 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
9of2[1] |
B | 51-nt Hypoxia Response Element (Reverse) | E | 100.0 /71.3 |
2 /3 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
9of2[1] |
B | 51-nt Hypoxia Response Element (Reverse) | F | 75.0 /33.2 |
4 /4 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
8osk[1] |
I | DNA (124-MER) | K | 100.0 /32.4 |
2 /2 |
CLOCK_MOUSE Circadian locomoter output cycles protein kaput |
|
|
8xs6[6] |
D | DNAR | A | 25.0 /31.5 |
4 /4 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
8xs6[6] |
D | DNAR | B | 100.0 /32.1 |
2 /7 |
I3LF82_PIG Aryl hydrocarbon receptor |
|
|
8osl[1] |
I | DNA (147-MER) | K | 60.0 /31.8 |
5 /6 |
CLOCK_MOUSE Circadian locomoter output cycles protein kaput |
|
|
4zpk[3] |
C | DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. | A | 44.4 /32.0 |
9 /9 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
4zpk[1] |
C | DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. | B | 80.0 /70.8 |
5 /5 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
4zpr[3] |
C | DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. | B | 100.0 /99.3 |
4 /4 |
HIF1A_MOUSE Hypoxia-inducible factor 1-alpha |
|
|
9of0[1] |
C | 20-nt Hypoxia Response Element DNA (Forward) | A | 100.0 /71.7 |
5 /5 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
4zpk[6] |
D | DNA (5'-D(*CP*AP*CP*GP*AP*CP*CP*CP*GP*CP*AP*CP*GP*.. | A | 33.3 /32.0 |
3 /3 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
9of0[1] |
D | 20-nt Hypoxia Response Element DNA (Reverse) | A | 87.5 /71.7 |
8 /8 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
9of0[1] |
D | 20-nt Hypoxia Response Element DNA (Reverse) | B | 50.0 /31.6 |
4 /4 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
8xs6[6] |
C | DNAF | A | 40.0 /31.5 |
10 /10 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
7xhv[1] |
C | DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. | A | 57.1 /31.2 |
7 /7 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
7xhv[2] |
C | DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. | B | 50.0 /29.1 |
2 /3 |
NPAS4_MOUSE Neuronal PAS domain-containing protein 4 |
|
|
7xi3[1] |
C | DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. | A | 44.4 /31.7 |
9 /9 |
Aryl hydrocarbon receptor nuclear translocator 2 |
|
|
7xhv[5] |
D | DNA (5'-D(P*CP*CP*AP*TP*CP*AP*CP*TP*CP*AP*CP*GP*AP.. | A | 20.0 /31.2 |
5 /5 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
7xi3[1] |
D | DNA (5'-D(P*CP*CP*AP*TP*CP*AP*CP*TP*CP*AP*CP*GP*AP.. | A | 25.0 /31.7 |
4 /4 |
Aryl hydrocarbon receptor nuclear translocator 2 |
|
|
7xi4[1] |
C | DNA (5'-D(*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP*.. | A | 33.3 /32.8 |
9 /9 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
7xi4[1] |
C | DNA (5'-D(*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP*.. | B | 50.0 /27.3 |
2 /2 |
A1L327_MOUSE Neuronal PAS domain protein 4 |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND |
|||||||
| 826 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
6x3d[1] |
C |
ULM
|
A | 66.7 /77.2 |
21 /21 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
3f1o[1] |
C |
2XY
|
A | 68.4 /76.9 |
19 /19 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
6x37[1] |
C |
ULS
|
A | 65.0 /76.9 |
20 /20 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
8ck4[1] |
C |
UY3
|
A | 73.7 /76.9 |
19 /19 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
3h7w[1] |
C |
018
|
A | 70.6 /76.7 |
17 /17 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
4gs9[1] |
D |
PE8
|
A | 80.0 /76.7 |
5 /5 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
5ufp[1] |
C |
86D
|
A | 66.7 /76.7 |
21 /21 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
6d09[1] |
C |
FOJ
|
A | 66.7 /76.7 |
21 /21 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
6x21[1] |
C |
UKJ
|
A | 63.6 /76.7 |
22 /22 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
6x28[1] |
C |
ULG
|
A | 63.6 /76.7 |
22 /22 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
8ck3[1] |
C |
UXU
|
A | 70.0 /76.4 |
20 /20 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
6czw[1] |
C |
FO7
|
A | 63.6 /76.2 |
22 /22 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
6d0b[1] |
C |
FOV
|
A | 60.9 /76.2 |
23 /23 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
6x2h[1] |
C |
ULD
|
A | 71.4 /76.2 |
21 /21 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
8ck8[1] |
C |
UYF
|
A | 68.4 /76.2 |
19 /19 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
3h82[1] |
C |
020
|
B | 68.4 /75.2 |
19 /19 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
4xt2[2] |
E |
43L
|
C | 60.0 /75.2 |
20 /20 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
4ghi[1] |
C |
0X3
|
A | 73.7 /76.7 |
19 /19 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
4zqd[1] |
E |
0X3
|
B | 86.7 /71.6 |
15 /15 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
4zph[1] |
E |
PRL
|
A | 100.0 /32.8 |
2 /2 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
4zph[1] |
E |
PRL
|
B | 60.0 /71.5 |
5 /5 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
9loh[1] |
C |
A1EJ8
|
B | 70.6 /71.2 |
17 /17 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
9loi[1] |
C |
A1EKA
|
B | 76.9 /71.1 |
13 /13 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
5tbm[1] |
C |
79A
|
A | 66.7 /76.2 |
21 /21 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
6e3s[1] |
C |
79A
|
B | 66.7 /71.1 |
21 /21 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
6e3u[1] |
C |
HNJ
|
B | 70.6 /70.9 |
17 /17 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
6e3t[1] |
C |
HO7
|
B | 76.9 /70.8 |
13 /13 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
9ljx[1] |
C |
A1EKB
|
B | 66.7 /70.7 |
18 /18 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
9ljy[1] |
C |
A1EJ9
|
B | 72.2 /70.7 |
18 /18 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
7w80[1] |
C |
72Q
|
B | 63.6 /70.4 |
22 /22 |
EPAS1_MOUSE Endothelial PAS domain-containing protein 1 |
|
|
7v7w[1] |
C |
5YM
|
B | 46.7 /62.5 |
15 /15 |
HIF3A_MOUSE Hypoxia-inducible factor 3-alpha |
|
|
8rw8[1] |
C |
A1H3Q
|
A | 50.0 /35.6 |
16 /16 |
BMAL1_HUMAN Basic helix-loop-helix ARNT-like protein 1 |
|
|
8xsa[1] |
F |
A1LWK
|
B | 28.6 /32.3 |
14 /17 |
I3LF82_PIG Aryl hydrocarbon receptor |
|
|
8xs9[1] |
F |
A1LWJ
|
B | 21.4 /32.2 |
14 /17 |
I3LF82_PIG Aryl hydrocarbon receptor |
|
|
8xs7[1] |
F |
A1LWI
|
B | 25.0 /32.2 |
16 /19 |
I3LF82_PIG Aryl hydrocarbon receptor |
|
|
8qmo[1] |
K |
W62
|
D | 23.1 /32.4 |
13 /14 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
8xs8[1] |
E |
W62
|
B | 22.2 /32.2 |
9 /12 |
I3LF82_PIG Aryl hydrocarbon receptor |
|
|
8xs6[1] |
E |
A1LWH
|
B | 23.1 /32.1 |
13 /15 |
I3LF82_PIG Aryl hydrocarbon receptor |
|
|
7zub[1] |
K |
JY6
|
D | 23.1 /32.1 |
13 /15 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
8xsb[1] |
E |
JY6
|
B | 23.1 /32.0 |
13 /16 |
I3LF82_PIG Aryl hydrocarbon receptor |
|
|
4eq1[2] |
C |
PE5
|
A | 25.0 /31.6 |
4 /4 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
8g4a[2] |
C |
YL8
|
A | 16.7 /31.6 |
6 /6 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
7vnh[2] |
C |
BHF
|
A | 21.4 /29.0 |
14 /14 |
O61543_DROME Ahr homolog spineless |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL |
|||||||
| 826 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
5nj8[2] |
I |
ER3
|
A | 0.0 /38.5 |
1 /1 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
5nj8[1] |
J |
ER3
|
A | 0.0 /38.5 |
2 /2 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
5nj8[2] |
L |
ER3
|
A | 100.0 /38.5 |
1 /1 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
5nj8[1] |
J |
ER3
|
B | 0.0 /31.6 |
1 /1 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
5nj8[1] |
M |
ER3
|
B | 100.0 /31.6 |
1 /1 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
5nj8[1] |
N |
ER3
|
B | 100.0 /31.6 |
1 /1 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
5nj8[1] |
O |
ER3
|
B | 0.0 /31.6 |
2 /2 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO |
|||||||
| 826 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
9ofu[2] |
C | HIF1A_HUMAN Hypoxia-inducible factor 1-alpha[300 aa] | A | 100.0 /100.0 |
6 /6 |
HIF1A_HUMAN Hypoxia-inducible factor 1-alpha |
|
|
9of2[1] |
E | EPAS1_HUMAN Endothelial PAS domain-containing protein 1[300 aa.. | C | 75.0 /71.9 |
4 /4 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
9of2[1] |
C | EPAS1_HUMAN Endothelial PAS domain-containing protein 1[307 aa.. | E | 100.0 /71.3 |
5 /5 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
4dj2[4] |
C | PER1_MOUSE Period circadian protein homolog 1[264 aa] | A | 50.0 /35.9 |
2 /15 |
PER1_MOUSE Period circadian protein homolog 1 |
|
|
4m4x[1] |
B | AHR_MOUSE Aryl hydrocarbon receptor[111 aa] | A | 75.0 /36.2 |
8 /20 |
AHR_MOUSE Aryl hydrocarbon receptor |
|
|
4m4x[1] |
A | AHR_MOUSE Aryl hydrocarbon receptor[126 aa] | B | 71.4 /36.2 |
7 /16 |
AHR_MOUSE Aryl hydrocarbon receptor |
|
|
9ofu[1] |
B | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[229.. | D | 25.0 /32.9 |
8 /8 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
1wa9[1] |
B | PER_DROME PERIOD CIRCADIAN PROTEIN[319 aa] | A | 28.6 /30.1 |
42 /48 |
PER_DROME PERIOD CIRCADIAN PROTEIN |
|
|
3rty[8] |
B | PER_DROME Period circadian protein[302 aa] | A | 20.0 /32.2 |
10 /48 |
PER_DROME Period circadian protein |
|
|
1wa9[1] |
A | PER_DROME PERIOD CIRCADIAN PROTEIN[318 aa] | B | 7.7 /32.2 |
13 /45 |
PER_DROME PERIOD CIRCADIAN PROTEIN |
|
|
2hv1[4] |
B | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[108.. | A | 38.5 /31.6 |
13 /18 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
4eq1[2] |
B | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[109.. | A | 33.3 /31.6 |
15 /19 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
9of2[3] |
F | ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[252.. | D | 33.3 /33.1 |
6 /6 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
5sy5[1] |
C | ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[269.. | A | 50.0 /31.4 |
2 /2 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
4dj3[1] |
A | PER3_MOUSE Period circadian protein homolog 3[298 aa] | B | 0.0 /26.2 |
9 /12 |
PER3_MOUSE Period circadian protein homolog 3 |
|
|
4dj3[1] |
B | PER3_MOUSE Period circadian protein homolog 3[265 aa] | A | 0.0 /25.2 |
9 /15 |
PER3_MOUSE Period circadian protein homolog 3 |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT |
|||||||
| 826 | pdb_id | contact mol | homologue | ||||
|
|
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
|
|
4wn5[2] |
D |
MVC
|
A | 50.0 /58.4 |
18 /18 |
HIF3A_HUMAN Hypoxia-inducible factor 3-alpha |
|
|
4wn5[3] |
E |
P6G
|
A | 25.0 /58.4 |
4 /4 |
HIF3A_HUMAN Hypoxia-inducible factor 3-alpha |
|
|
4wn5[2] |
F |
P6G
|
A | 100.0 /58.4 |
3 /3 |
HIF3A_HUMAN Hypoxia-inducible factor 3-alpha |
|
|
5v0l[1] |
F |
CIT
|
B | 0.0 /39.2 |
1 /1 |
AHR_MOUSE Aryl hydrocarbon receptor |
|
|
3f1n[1] |
C |
EDO
|
A | 100.0 /76.7 |
8 /8 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
3f1n[1] |
D |
EDO
|
A | 57.1 /76.7 |
7 /7 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
3f1n[2] |
E |
EDO
|
A | 100.0 /76.7 |
5 /5 |
EPAS1_HUMAN Endothelial PAS domain-containing protein 1 |
|
|
5f5y[2] |
B |
EDO
|
A | 40.0 /36.0 |
10 /10 |
CYCL_DROME Protein cycle |
|
|
5f69[1] |
B |
GOL
|
A | 54.5 /36.0 |
11 /11 |
CYCL_DROME Protein cycle |
|
|
5y7y[1] |
C |
GOL
|
A | 16.7 /34.0 |
6 /9 |
AHRR_HUMAN Aryl hydrocarbon receptor repressor |
|
|
5y7y[1] |
E |
GOL
|
B | 50.0 /32.5 |
2 /2 |
ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator |
|
|
3rty[8] |
I |
DTT
|
A | 25.0 /32.2 |
4 /8 |
PER_DROME Period circadian protein |
|
|
3rty[8] |
J |
DTT
|
A | 50.0 /32.2 |
2 /3 |
PER_DROME Period circadian protein |
|
|
3rty[5] |
L |
DTT
|
A | 33.3 /32.2 |
3 /3 |
PER_DROME Period circadian protein |
|
|
8xs7[3] |
E |
DTT
|
A | 0.0 /31.5 |
3 /3 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
8xs7[3] |
E |
DTT
|
B | 0.0 /32.2 |
1 /1 |
I3LF82_PIG Aryl hydrocarbon receptor |
|
|
8ck3[1] |
D |
DMS
|
B | 14.3 /31.6 |
7 /7 |
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator |
|
|
5nj8[1] |
K |
ACT
|
A | 0.0 /38.5 |
1 /1 |
AHR_HUMAN Aryl hydrocarbon receptor |
|
|
5nj8[1] |
K |
ACT
|
B | 0.0 /31.6 |
2 /2 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
|
|
4wn5[1] |
C |
SO4
|
A | 100.0 /58.4 |
1 /6 |
HIF3A_HUMAN Hypoxia-inducible factor 3-alpha |
|
|
7vni[2] |
E |
SO4
|
A | 0.0 /29.5 |
1 /2 |
O61543_DROME Ahr homolog spineless |
|
|
7vni[1] |
F |
SO4
|
A | 0.0 /29.5 |
2 /2 |
O61543_DROME Ahr homolog spineless |
|
|
7vni[1] |
F |
SO4
|
B | 33.3 /31.6 |
3 /3 |
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator |
| 3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||