HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

1684915

826

162

Q16665(HIF1A_HUMAN)

RecName: Full=Hypoxia-inducible factor 1-alpha ; Short=HIF-1-alpha ; Short=HIF1-alpha ;AltName: Full=ARNT-interacting protein;AltName: Full=Basic-helix-loop-helix-PAS protein MOP1 ;AltName: Full=Class E basic helix-loop-helix protein 78; Short=bHLHe78;AltName: Full=Member of PAS protein 1 ;AltName: Full=PAS domain-containing protein 8;

QUERYSEQ

MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTH
RNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAM
SPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSL
SWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q16665(HIF1A_HUMAN)]

826
	region	name	description
	1-826	CHAIN	/note="Hypoxia-inducible factor 1-alpha" /id="PRO_0000127220"
	17-70	DOMAIN	/note="bHLH"
	85-158	DOMAIN	/note="PAS 1"
	228-298	DOMAIN	/note="PAS 2"
	302-345	DOMAIN	/note="PAC"
	1-401	REGION	/note="Interaction with TSGA10"
	1-30	REGION	/note="Disordered"
	21-30	REGION	/note="DNA-binding"
	170-191	REGION	/note="Required for heterodimer formation with ARNT"
	380-417	REGION	/note="N-terminal VHL recognition site"
	401-603	REGION	/note="ODD"
	494-520	REGION	/note="Disordered"
	531-575	REGION	/note="NTAD" ECO:0000303\|PubMed:9235919"
	556-572	REGION	/note="C-terminal VHL recognition site"
	576-785	REGION	/note="ID"
	642-688	REGION	/note="Disordered"
	786-826	REGION	/note="CTAD" ECO:0000303\|PubMed:9235919"
	494-516	COMPBIAS	/note="Polar residues"
	645-670	COMPBIAS	/note="Polar residues"
	1-826	DISORDER	predicted by DISOPRED

MONOMER

826

pdb_id a¹ identity[%]² description

4zpr B 99.3 HIF1A_MOUSE Hypoxia-inducible factor 1-alpha

4zpk B 70.8 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

1l8c B 100.0 HIF1A_HUMAN Hypoxia-inducible factor 1 alpha

1wa9 A 30.1 PER_DROME PERIOD CIRCADIAN PROTEIN

5l9b C 100.0 HIF1A_HUMAN Hypoxia-inducible factor 1-alpha

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

826 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1h2l[2] A Q969Q7 FACTOR INHIBITING HIF1[332 aa] B 100.0
/100.0 18
/18 HIFA_HUMAN HYPOXIA-INDUCIBLE FACTOR 1 ALPHA

1h2l[2] A Q969Q7 FACTOR INHIBITING HIF1[332 aa] B 100.0
/100.0 1
/1 HIFA_HUMAN HYPOXIA-INDUCIBLE FACTOR 1 ALPHA

1h2m[2] A Q969Q7 FACTOR INHIBITING HIF1[332 aa] B 100.0
/100.0 18
/18 HIFA_HUMAN HYPOXIA-INDUCIBLE FACTOR 1 ALPHA

1h2m[2] A Q969Q7 FACTOR INHIBITING HIF1[332 aa] B 100.0
/100.0 1
/1 HIFA_HUMAN HYPOXIA-INDUCIBLE FACTOR 1 ALPHA

1l3e[4] B EP300_HUMAN p300 protein[101 aa] A 100.0
/100.0 27
/27 HIF1A_HUMAN hypoxia inducible factor-1 alpha subunit

5l9b[2] A EGLN1_HUMAN Egl nine homolog 1[222 aa] C 100.0
/100.0 16
/16 HIF1A_HUMAN Hypoxia-inducible factor 1-alpha

4zpr[1] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[235.. B 100.0
/99.3 52
/52 HIF1A_MOUSE Hypoxia-inducible factor 1-alpha

2a24[1] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[108.. A 76.9
/75.5 26
/26 EPAS1_HUMAN Endothelial PAS domain protein 1

3f1n[22] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[112.. A 83.3
/76.7 18
/18 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

4h6j[1] B ARNT_HUMAN ARYL HYDROCARBON NUCLEAR TRANSLOCATOR[111 aa] A 93.3
/99.1 15
/15 HIF1A_HUMAN HYPOXIA INDUCIBLE FACTOR 1-ALPHA

5tbm[5] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[110.. A 90.9
/76.2 11
/11 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

7vni[2] B ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[104.. A 36.4
/29.5 11
/11 O61543_DROME Ahr homolog spineless

7v7l[2] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[280.. B 59.2
/60.8 76
/76 HIF3A_MOUSE Hypoxia-inducible factor 3-alpha

5sy5[4] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[278.. B 48.6
/45.9 72
/83 NPAS1_MOUSE Neuronal PAS domain-containing protein 1

5sy5[2] E ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[279.. B 33.3
/45.9 3
/3 NPAS1_MOUSE Neuronal PAS domain-containing protein 1

5v0l[1] A ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[176.. B 44.4
/39.2 36
/44 AHR_MOUSE Aryl hydrocarbon receptor

5nj8[1] B ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[174.. A 45.2
/38.5 31
/43 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[1] D ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[134.. C 41.9
/36.4 31
/35 AHR_HUMAN Aryl hydrocarbon receptor

4f3l[1] B CLOCK_MOUSE Circadian locomoter output cycles protein kaput[31.. A 36.8
/34.3 76
/84 Q6F6D6_MOUSE BMAL1b

8osk[2] K CLOCK_MOUSE Circadian locomoter output cycles protein kaput[31.. L 16.7
/35.1 12
/12 BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1

5y7y[1] B ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator[263.. A 38.9
/34.0 36
/63 AHRR_HUMAN Aryl hydrocarbon receptor repressor

7zub[4] A HS90B_HUMAN Heat shock protein HSP 90-beta[624 aa] D 30.0
/32.1 20
/21 AHR_HUMAN Aryl hydrocarbon receptor

8h77[1] F AIP_MOUSE AH receptor-interacting protein[310 aa] E 0.0
/33.3 2
/9 AHR_MOUSE Aryl hydrocarbon receptor

4lpz[4] C Transforming acidic coiled-coil-containing protein.. A 33.3
/33.3 6
/6 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

7xi3[2] B A1L327_MOUSE Neuronal PAS domain protein 4[314 aa] A 29.8
/31.7 47
/53 Aryl hydrocarbon receptor nuclear translocator 2

4pky[2] B TACC3_MOUSE Transforming acidic coiled-coil-containing protein.. A 28.6
/32.6 14
/14 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

4pky[2] C TACC3_MOUSE Transforming acidic coiled-coil-containing protein.. A 40.0
/32.6 5
/6 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

5y7y[1] A AHRR_HUMAN Aryl hydrocarbon receptor repressor[201 aa] B 34.0
/32.5 50
/56 ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator

8osk[1] H H2B1J_HUMAN Histone H2B type 1-J[94 aa] K 0.0
/32.4 1
/1 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

7zub[1] C AIP_HUMAN AH receptor-interacting protein[304 aa] D 0.0
/32.1 2
/18 AHR_HUMAN Aryl hydrocarbon receptor

4zpk[1] B EPAS1_MOUSE Endothelial PAS domain-containing protein 1[321 aa.. A 38.7
/32.0 62
/67 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

4f3l[1] A Q6F6D6_MOUSE BMAL1b[302 aa] B 32.9
/31.5 85
/88 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

8osk[2] L BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1[285 aa].. K 30.8
/32.4 13
/13 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

8osk[2] E H31_HUMAN Histone H3.1[94 aa] K 0.0
/32.4 2
/2 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

7v7l[2] B HIF3A_MOUSE Hypoxia-inducible factor 3-alpha[299 aa] A 34.8
/31.4 69
/75 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

2a24[1] A EPAS1_HUMAN Endothelial PAS domain protein 1[107 aa] B 30.0
/31.6 20
/25 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

3f1n[22] A EPAS1_HUMAN Endothelial PAS domain-containing protein 1[108 aa.. B 38.9
/31.6 18
/21 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

5tbm[2] A EPAS1_HUMAN Endothelial PAS domain-containing protein 1[106 aa.. B 20.0
/31.6 10
/10 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

6czw[3] A EPAS1_HUMAN Endothelial PAS domain-containing protein 1[109 aa.. B 30.0
/31.6 10
/10 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

4h6j[1] A HIF1A_HUMAN HYPOXIA INDUCIBLE FACTOR 1-ALPHA[106 aa] B 37.5
/31.6 16
/18 ARNT_HUMAN ARYL HYDROCARBON NUCLEAR TRANSLOCATOR

7vni[2] A O61543_DROME Ahr homolog spineless[110 aa] B 36.4
/31.6 11
/11 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[1] A AHR_HUMAN Aryl hydrocarbon receptor[176 aa] B 24.3
/31.6 37
/41 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5sy5[3] B NPAS1_MOUSE Neuronal PAS domain-containing protein 1[278 aa] A 32.4
/31.4 74
/80 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5sy5[1] D NPAS1_MOUSE Neuronal PAS domain-containing protein 1[283 aa] A 44.4
/31.4 9
/11 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5sy5[1] B NPAS1_MOUSE Neuronal PAS domain-containing protein 1[278 aa] E 40.0
/31.5 5
/5 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

4zp4[10] B EPAS1_MOUSE Endothelial PAS domain-containing protein 1[295 aa.. A 37.7
/32.4 53
/58 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

7xhv[1] B NPAS4_MOUSE Neuronal PAS domain-containing protein 4[192 aa] A 20.0
/31.2 35
/41 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5v0l[1] B AHR_MOUSE Aryl hydrocarbon receptor[166 aa] A 30.4
/30.8 23
/34 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

4zpr[1] B HIF1A_MOUSE Hypoxia-inducible factor 1-alpha[279 aa] A 32.5
/30.5 40
/51 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5sy7[1] B NPAS3_MOUSE Neuronal PAS domain-containing protein 3[276 aa] A 32.1
/29.2 53
/76 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

7xi3[1] A Aryl hydrocarbon receptor nuclear translocator 2[2.. B 29.3
/27.4 58
/61 A1L327_MOUSE Neuronal PAS domain protein 4

4zp4[11] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[261.. B 71.9
/71.2 64
/66 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

7xhv[2] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[177.. B 28.9
/29.1 38
/47 NPAS4_MOUSE Neuronal PAS domain-containing protein 4

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

826 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

4zpk[3] C DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. A 44.4
/32.0 9
/9 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

4zpk[1] C DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. B 80.0
/70.8 5
/5 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

4zpr[2] C DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. B 100.0
/99.3 4
/4 HIF1A_MOUSE Hypoxia-inducible factor 1-alpha

4zpk[6] D DNA (5'-D(*CP*AP*CP*GP*AP*CP*CP*CP*GP*CP*AP*CP*GP*.. A 33.3
/32.0 3
/3 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5v0l[1] C DNA (5'-D(P*GP*GP*AP*TP*TP*GP*CP*GP*TP*GP*AP*GP*AP.. A 25.0
/30.8 8
/8 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

5v0l[1] C DNA (5'-D(P*GP*GP*AP*TP*TP*GP*CP*GP*TP*GP*AP*GP*AP.. B 0.0
/39.2 1
/4 AHR_MOUSE Aryl hydrocarbon receptor

5v0l[1] D DNA (5'-D(P*AP*GP*TP*TP*CP*TP*CP*AP*CP*GP*CP*AP*AP.. A 100.0
/30.8 1
/1 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

5v0l[1] D DNA (5'-D(P*AP*GP*TP*TP*CP*TP*CP*AP*CP*GP*CP*AP*AP.. B 100.0
/39.2 1
/2 AHR_MOUSE Aryl hydrocarbon receptor

5nj8[2] E DNA (5'-D(*GP*GP*TP*CP*AP*CP*GP*CP*AP*AP*CP*C)-3').. A 66.7
/38.5 3
/7 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[1] E DNA (5'-D(*GP*GP*TP*CP*AP*CP*GP*CP*AP*AP*CP*C)-3').. B 25.0
/31.6 4
/4 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[1] F DNA (5'-D(*GP*GP*TP*TP*GP*CP*GP*TP*GP*AP*CP*C)-3').. B 36.4
/31.6 11
/11 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[1] H DNA (5'-D(*GP*GP*TP*TP*GP*CP*GP*TP*GP*AP*CP*C)-3').. C 25.0
/36.4 4
/4 AHR_HUMAN Aryl hydrocarbon receptor

8osk[1] J DNA (124-MER) L 50.0
/35.1 4
/4 BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1

8osl[1] J DNA (147-MER) K 0.0
/31.8 1
/1 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

8osl[1] J DNA (147-MER) L 42.9
/35.1 7
/7 BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1

8osk[1] I DNA (124-MER) K 100.0
/32.4 2
/2 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

8osl[1] I DNA (147-MER) K 60.0
/31.8 5
/6 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

7xhv[1] C DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. A 57.1
/31.2 7
/7 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

7xhv[2] C DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. B 50.0
/29.1 2
/3 NPAS4_MOUSE Neuronal PAS domain-containing protein 4

7xi3[1] C DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. A 44.4
/31.7 9
/9 Aryl hydrocarbon receptor nuclear translocator 2

7xhv[5] D DNA (5'-D(P*CP*CP*AP*TP*CP*AP*CP*TP*CP*AP*CP*GP*AP.. A 20.0
/31.2 5
/5 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

7xi3[1] D DNA (5'-D(P*CP*CP*AP*TP*CP*AP*CP*TP*CP*AP*CP*GP*AP.. A 25.0
/31.7 4
/4 Aryl hydrocarbon receptor nuclear translocator 2

7xi4[1] C DNA (5'-D(*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP*.. A 33.3
/32.8 9
/9 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

7xi4[1] C DNA (5'-D(*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP*.. B 50.0
/27.3 2
/2 A1L327_MOUSE Neuronal PAS domain protein 4

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

826 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5l9b[2] F AKG
2-OXOGLUTARIC ACID[10 atoms] C 100.0
/100.0 1
/1 HIF1A_HUMAN Hypoxia-inducible factor 1-alpha

6x3d[1] C ULM
(6R,7S)-4-[(3,3-difluorocyclobutyl)oxy]-6-fluoro-1.. A 66.7
/77.2 21
/21 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

3f1o[1] C 2XY
N-[2-nitro-4-(trifluoromethyl)phenyl]morpholin-4-a.. A 68.4
/76.9 19
/19 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6x37[1] C ULS
3-fluoro-5-{[(7R)-7-hydroxy-1-(trifluoromethyl)-6,.. A 65.0
/76.9 20
/20 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

8ck4[1] C UY3
(4~{S})-1-[3,5-bis(fluoranyl)phenyl]-5,5-bis(fluor.. A 73.7
/76.9 19
/19 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

3h7w[1] C 018
2-nitro-N-(thiophen-3-ylmethyl)-4-(trifluoromethyl.. A 70.6
/76.7 17
/17 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

4gs9[1] D PE8
3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL[25 a.. A 80.0
/76.7 5
/5 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

5ufp[1] C 86D
3-({(1S)-7-[(difluoromethyl)sulfonyl]-2,2-difluoro.. A 66.7
/76.7 21
/21 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6d09[1] C FOJ
3-{[(3R)-4-(difluoromethyl)-2,2-difluoro-3-hydroxy.. A 66.7
/76.7 21
/21 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6x21[1] C UKJ
1-(3-bromo-5-fluorophenoxy)-4-[(difluoromethyl)sul.. A 63.6
/76.7 22
/22 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6x28[1] C ULG
(1R)-4-(3,5-difluorophenoxy)-7-(trifluoromethyl)-2.. A 63.6
/76.7 22
/22 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

8ck3[1] C UXU
(4~{S})-1-[3,5-bis(fluoranyl)phenyl]-5,5-bis(fluor.. A 70.0
/76.4 20
/20 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6czw[1] C FO7
{2-bromo-3-(3-chloro-5-fluorophenoxy)-6-[(difluoro.. A 63.6
/76.2 22
/22 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6d0b[1] C FOV
N-(3-chloro-5-fluorophenyl)-2-nitro-4-[(trifluorom.. A 60.9
/76.2 23
/23 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6x2h[1] C ULD
cis-3-({(1S)-7-[dihydroxy(trifluoromethyl)-lambda~.. A 71.4
/76.2 21
/21 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

8ck8[1] C UYF
(4~{S})-1-cyclohexyloxy-5,5-bis(fluoranyl)-3-methy.. A 68.4
/76.2 19
/19 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

3h82[1] C 020
N-(furan-2-ylmethyl)-2-nitro-4-(trifluoromethyl)an.. B 68.4
/75.2 19
/19 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

4xt2[2] E 43L
(5S,7R)-5,7-bis(3-bromophenyl)-4,5,6,7-tetrahydrot.. C 60.0
/75.2 20
/20 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

4ghi[1] C 0X3
N-(3-chloro-5-fluorophenyl)-4-nitro-2,1,3-benzoxad.. A 73.7
/76.7 19
/19 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

4zqd[1] E 0X3
N-(3-chloro-5-fluorophenyl)-4-nitro-2,1,3-benzoxad.. B 86.7
/71.6 15
/15 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

4zph[1] E PRL
PROFLAVIN[16 atoms] A 100.0
/32.8 2
/2 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

4zph[1] E PRL
PROFLAVIN[16 atoms] B 60.0
/71.5 5
/5 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

5tbm[1] C 79A
3-{[(1S)-2,2-difluoro-1-hydroxy-7-(methylsulfonyl).. A 66.7
/76.2 21
/21 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6e3s[1] C 79A
3-{[(1S)-2,2-difluoro-1-hydroxy-7-(methylsulfonyl).. B 66.7
/71.1 21
/21 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

6e3u[1] C HNJ
3-{[2-(pyrrolidin-1-yl)phenyl]amino}-1H-1lambda~6~.. B 70.6
/70.9 17
/17 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

6e3t[1] C HO7
(6S)-6-(4-bromophenyl)-2,3,5,6-tetrahydroimidazo[2.. B 76.9
/70.8 13
/13 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

7w80[1] C 72Q
3-{[(1S,2S,3R)-2,3-difluoro-1-hydroxy-7-(methylsul.. B 63.6
/70.4 22
/22 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

7v7w[1] C 5YM
(Z)-N-(2-hydroxyethyl)octadec-9-enamide[23 atoms] B 46.7
/62.5 15
/15 HIF3A_MOUSE Hypoxia-inducible factor 3-alpha

7zub[1] K JY6
(3~{Z})-3-(3-oxidanylidene-1~{H}-indol-2-ylidene)-.. D 23.1
/32.1 13
/15 AHR_HUMAN Aryl hydrocarbon receptor

4eq1[2] C PE5
3,6,9,12,15,18,21,24-OCTAOXAHEXACOSAN-1-OL[14 atom.. A 25.0
/31.6 4
/4 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

7vnh[2] C BHF
2-PHENYL-4H-BENZO[H]CHROMEN-4-ONE[21 atoms] A 21.4
/29.0 14
/14 O61543_DROME Ahr homolog spineless

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

826 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5nj8[2] I ER3
ERBIUM (III) ION[1 atoms] A 0.0
/38.5 1
/1 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[1] J ER3
ERBIUM (III) ION[1 atoms] A 0.0
/38.5 2
/2 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[2] L ER3
ERBIUM (III) ION[1 atoms] A 100.0
/38.5 1
/1 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[1] J ER3
ERBIUM (III) ION[1 atoms] B 0.0
/31.6 1
/1 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[1] M ER3
ERBIUM (III) ION[1 atoms] B 100.0
/31.6 1
/1 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[1] N ER3
ERBIUM (III) ION[1 atoms] B 100.0
/31.6 1
/1 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[1] O ER3
ERBIUM (III) ION[1 atoms] B 0.0
/31.6 2
/2 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

826 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

4dj2[4] C PER1_MOUSE Period circadian protein homolog 1[264 aa] A 50.0
/35.9 2
/15 PER1_MOUSE Period circadian protein homolog 1

4m4x[1] B AHR_MOUSE Aryl hydrocarbon receptor[111 aa] A 75.0
/36.2 8
/20 AHR_MOUSE Aryl hydrocarbon receptor

4m4x[1] A AHR_MOUSE Aryl hydrocarbon receptor[126 aa] B 71.4
/36.2 7
/16 AHR_MOUSE Aryl hydrocarbon receptor

1wa9[1] B PER_DROME PERIOD CIRCADIAN PROTEIN[319 aa] A 28.6
/30.1 42
/48 PER_DROME PERIOD CIRCADIAN PROTEIN

3rty[8] B PER_DROME Period circadian protein[302 aa] A 20.0
/32.2 10
/48 PER_DROME Period circadian protein

1wa9[1] A PER_DROME PERIOD CIRCADIAN PROTEIN[318 aa] B 7.7
/32.2 13
/45 PER_DROME PERIOD CIRCADIAN PROTEIN

2hv1[2] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[108.. A 38.5
/31.6 13
/18 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

4eq1[2] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[109.. A 33.3
/31.6 15
/19 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

5sy5[1] C ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[269.. A 50.0
/31.4 2
/2 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

4dj3[1] A PER3_MOUSE Period circadian protein homolog 3[298 aa] B 0.0
/26.2 9
/12 PER3_MOUSE Period circadian protein homolog 3

4dj3[1] B PER3_MOUSE Period circadian protein homolog 3[265 aa] A 0.0
/25.2 9
/15 PER3_MOUSE Period circadian protein homolog 3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

826 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

4wn5[2] D MVC
MONOVACCENIN[25 atoms] A 50.0
/58.4 18
/18 HIF3A_HUMAN Hypoxia-inducible factor 3-alpha

4wn5[3] E P6G
HEXAETHYLENE GLYCOL[19 atoms] A 25.0
/58.4 4
/4 HIF3A_HUMAN Hypoxia-inducible factor 3-alpha

4wn5[2] F P6G
HEXAETHYLENE GLYCOL[19 atoms] A 100.0
/58.4 3
/3 HIF3A_HUMAN Hypoxia-inducible factor 3-alpha

5v0l[1] F CIT
CITRIC ACID[13 atoms] B 0.0
/39.2 1
/1 AHR_MOUSE Aryl hydrocarbon receptor

3f1n[1] C EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/76.7 8
/8 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

3f1n[1] D EDO
1,2-ETHANEDIOL[4 atoms] A 57.1
/76.7 7
/7 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

3f1n[2] E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/76.7 5
/5 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

5f5y[2] B EDO
1,2-ETHANEDIOL[4 atoms] A 40.0
/36.0 10
/10 CYCL_DROME Protein cycle

5f69[1] B GOL
GLYCEROL[6 atoms] A 54.5
/36.0 11
/11 CYCL_DROME Protein cycle

5y7y[1] C GOL
GLYCEROL[6 atoms] A 16.7
/34.0 6
/9 AHRR_HUMAN Aryl hydrocarbon receptor repressor

5y7y[1] E GOL
GLYCEROL[6 atoms] B 50.0
/32.5 2
/2 ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator

3rty[8] I DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] A 25.0
/32.2 4
/8 PER_DROME Period circadian protein

3rty[8] J DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] A 50.0
/32.2 2
/3 PER_DROME Period circadian protein

3rty[5] L DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] A 33.3
/32.2 3
/3 PER_DROME Period circadian protein

8ck3[1] D DMS
DIMETHYL SULFOXIDE[4 atoms] B 14.3
/31.6 7
/7 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

5nj8[1] K ACT
ACETATE ION[4 atoms] A 0.0
/38.5 1
/1 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[1] K ACT
ACETATE ION[4 atoms] B 0.0
/31.6 2
/2 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

4wn5[1] C SO4
SULFATE ION[5 atoms] A 100.0
/58.4 1
/6 HIF3A_HUMAN Hypoxia-inducible factor 3-alpha

7vni[2] E SO4
SULFATE ION[5 atoms] A 0.0
/29.5 1
/2 O61543_DROME Ahr homolog spineless

7vni[1] F SO4
SULFATE ION[5 atoms] A 0.0
/29.5 2
/2 O61543_DROME Ahr homolog spineless

7vni[1] F SO4
SULFATE ION[5 atoms] B 33.3
/31.6 3
/3 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
826
	pdb_id	a¹	identity[%]²	description
	4zpr	B	99.3	HIF1A_MOUSE Hypoxia-inducible factor 1-alpha
	4zpk	B	70.8	EPAS1_MOUSE Endothelial PAS domain-containing protein 1
	1l8c	B	100.0	HIF1A_HUMAN Hypoxia-inducible factor 1 alpha
	1wa9	A	30.1	PER_DROME PERIOD CIRCADIAN PROTEIN
	5l9b	C	100.0	HIF1A_HUMAN Hypoxia-inducible factor 1-alpha
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [Q16665(HIF1A_HUMAN)]