Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4026637 131 0 Q16553(LY6E_HUMAN) RecName: Full=Lymphocyte antigen 6E ; Short=Ly-6E;AltName: Full=Retinoic acid-induced gene E protein; Short=RIG-E;AltName: Full=Stem cell antigen 2; Short=SCA-2;AltName: Full=Thymic shared antigen 1; Short=TSA-1;Flags: Precursor;
QUERYSEQ
MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q16553(LY6E_HUMAN)]

131
region name description
1-20 SIGNAL
21-101 CHAIN /note="Lymphocyte antigen 6E" /id="PRO_0000036138"
102-131 PROPEP /note="Removed in mature form" /id="PRO_0000036139"
21-101 DOMAIN /note="UPAR/Ly6"
101-101 LIPID /note="GPI-anchor amidated serine"
1-13 DISORDER predicted by DISOPRED

No homologue is found in PDB.

Please check [SiteTable] for homologues.