HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
1689191	155	81	Q16552(IL17_HUMAN)	RecName: Full=Interleukin-17A; Short=IL-17; Short=IL-17A;AltName: Full=Cytotoxic T-lymphocyte-associated antigen 8; Short=CTLA-8;Flags: Precursor;
QUERYSEQ	MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPI VHHVA

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q16552(IL17_HUMAN)]

155
	region	name	description
	1-23	SIGNAL
	24-155	CHAIN	/note="Interleukin-17A" /id="PRO_0000015423"
	1-155	DISORDER	predicted by DISOPRED

MONOMER

155

pdb_id a¹ identity[%]² description

4qhu E 99.2 IL17_HUMAN Interleukin-17A

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

155 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2vxs[6] E FAB FRAGMENT[216 aa] A 100.0
/100.0 6
/6 IL17_HUMAN INTERLEUKIN-17A

2vxs[6] F FAB FRAGMENT[221 aa] A 100.0
/100.0 6
/6 IL17_HUMAN INTERLEUKIN-17A

5hhv[2] C CAT-2000 FAB heavy chain[220 aa] A 100.0
/97.8 10
/10 IL17_HUMAN Interleukin-17A

5hhv[2] C CAT-2000 FAB heavy chain[220 aa] A 100.0
/97.8 5
/5 IL17_HUMAN Interleukin-17A

5hi3[6] C CAT-2000 FAB heavy chain[220 aa] A 100.0
/100.0 8
/8 IL17_HUMAN Interleukin-17A

5hi3[6] E CAT-2000 FAB heavy chain[220 aa] A 100.0
/100.0 7
/7 IL17_HUMAN Interleukin-17A

2vxs[6] J FAB FRAGMENT[215 aa] A 100.0
/100.0 5
/5 IL17_HUMAN INTERLEUKIN-17A

5hhv[2] E CAT-2000 FAB light chain[213 aa] A 100.0
/97.8 5
/5 IL17_HUMAN Interleukin-17A

5hi3[6] D CAT-2000 FAB light chain[213 aa] A 100.0
/100.0 5
/5 IL17_HUMAN Interleukin-17A

5hhv[2] D IL-17A peptide inhibitor[14 aa] A 100.0
/97.8 6
/6 IL17_HUMAN Interleukin-17A

5hhv[2] D IL-17A peptide inhibitor[14 aa] A 100.0
/97.8 8
/8 IL17_HUMAN Interleukin-17A

5hhx[2] D IL-17A peptide inhibitor[14 aa] A 100.0
/100.0 6
/6 IL17_HUMAN Interleukin-17A

5hhx[2] D IL-17A peptide inhibitor[14 aa] A 100.0
/100.0 9
/9 IL17_HUMAN Interleukin-17A

5hi3[3] F synthetic IL-17A peptide inhibitor[14 aa] A 100.0
/100.0 15
/15 IL17_HUMAN Interleukin-17A

5hi3[3] F synthetic IL-17A peptide inhibitor[14 aa] B 100.0
/100.0 5
/5 IL17_HUMAN Interleukin-17A

5n7w[2] A Antibody Fragment Heavy Chain[220 aa] E 100.0
/100.0 5
/5 IL17_HUMAN Interleukin-17A

5n7w[2] C Antibody Fragment Heavy Chain[216 aa] E 100.0
/100.0 4
/4 IL17_HUMAN Interleukin-17A

5n7w[2] B Antibody Fragment Light Chain[210 aa] E 100.0
/100.0 4
/4 IL17_HUMAN Interleukin-17A

5n7w[2] D Antibody Fragment Light Chain[211 aa] E 100.0
/100.0 15
/15 IL17_HUMAN Interleukin-17A

5n92[3] B IL17F_HUMAN Interleukin-17F[120 aa] A 100.0
/100.0 54
/54 IL17_HUMAN Interleukin-17A

6wio[4] A Fab Heavy chain[230 aa] C 100.0
/100.0 10
/10 IL17_HUMAN Interleukin-17A

6wio[4] A Fab Heavy chain[230 aa] C 100.0
/100.0 4
/4 IL17_HUMAN Interleukin-17A

7uwn[1] F I17RA_HUMAN Interleukin-17 receptor A[237 aa] D 100.0
/100.0 19
/19 IL17_HUMAN Interleukin-17A

7uwn[1] F I17RA_HUMAN Interleukin-17 receptor A[237 aa] E 100.0
/100.0 24
/24 IL17_HUMAN Interleukin-17A

7wkx[2] A Heavy chain of HB0017 Fab[217 aa] E 100.0
/100.0 1
/1 IL17_HUMAN Interleukin-17A

7wkx[2] B Heavy chain of HB0017 Fab[212 aa] E 100.0
/100.0 10
/10 IL17_HUMAN Interleukin-17A

7wkx[2] D Light chain of HB0017 Fab[216 aa] E 100.0
/100.0 5
/5 IL17_HUMAN Interleukin-17A

4qhu[2] A Fab6785 light chain[209 aa] E 100.0
/99.2 19
/19 IL17_HUMAN Interleukin-17A

4qhu[1] C Fab6785 light chain[209 aa] E 100.0
/99.2 3
/3 IL17_HUMAN Interleukin-17A

4qhu[1] A Fab6785 light chain[209 aa] F 100.0
/99.0 1
/1 IL17_HUMAN Interleukin-17A

4qhu[2] B Fab6785 heavy chain[211 aa] E 100.0
/99.2 8
/8 IL17_HUMAN Interleukin-17A

6ppg[2] B Fab MCAF5352A light chain[212 aa] A 100.0
/55.2 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[2] E Fab MCAF5352A light chain[216 aa] A 42.9
/55.2 7
/7 IL17F_HUMAN Interleukin-17F

6wio[4] B Fab Light chain[213 aa] C 100.0
/100.0 4
/4 IL17_HUMAN Interleukin-17A

6wio[4] B Fab Light chain[213 aa] C 100.0
/100.0 4
/4 IL17_HUMAN Interleukin-17A

7z2m[4] C 11.003 Fab light-chain[213 aa] G 100.0
/99.0 9
/9 IL17_HUMAN Interleukin-17A

7z2m[4] L 11.003 Fab light-chain[213 aa] G 100.0
/99.0 2
/2 IL17_HUMAN Interleukin-17A

7z2m[4] D 11.003 Fab heavy-chain[220 aa] G 100.0
/99.0 13
/13 IL17_HUMAN Interleukin-17A

7z2m[1] D 11.003 Fab heavy-chain[220 aa] I 100.0
/99.0 2
/2 IL17_HUMAN Interleukin-17A

8dy1[2] C scFv CAT2200 LH[228 aa] A 100.0
/98.0 7
/7 IL17_HUMAN Interleukin-17A

3jvf[6] C I17RA_HUMAN Interleukin-17 receptor A[271 aa] A 66.7
/58.3 15
/16 IL17F_HUMAN Interleukin-17F

3jvf[6] C I17RA_HUMAN Interleukin-17 receptor A[271 aa] B 36.0
/55.8 25
/25 IL17F_HUMAN Interleukin-17F

4hsa[4] C I17RA_HUMAN Interleukin-17 receptor A[272 aa] A 100.0
/98.1 20
/20 IL17_HUMAN Interleukin-17A

4hsa[4] C I17RA_HUMAN Interleukin-17 receptor A[272 aa] B 100.0
/98.2 23
/23 IL17_HUMAN Interleukin-17A

6hg4[4] B I17RC_HUMAN Interleukin-17 receptor C[427 aa] A 52.4
/57.3 21
/21 IL17F_HUMAN Interleukin-17F

6hg4[4] B I17RC_HUMAN Interleukin-17 receptor C[427 aa] A 75.0
/57.3 16
/16 IL17F_HUMAN Interleukin-17F

7uwn[1] G I17RC_HUMAN Isoform 5 of Interleukin-17 receptor C[403 aa] A 100.0
/100.0 19
/19 IL17_HUMAN Interleukin-17A

7uwn[1] G I17RC_HUMAN Isoform 5 of Interleukin-17 receptor C[403 aa] B 100.0
/100.0 9
/9 IL17_HUMAN Interleukin-17A

7zan[2] D I17RC_HUMAN Isoform 2 of Interleukin-17 receptor C[422 aa] A 100.0
/98.2 20
/20 IL17_HUMAN Interleukin-17A

7zan[2] D I17RC_HUMAN Isoform 2 of Interleukin-17 receptor C[422 aa] B 100.0
/98.2 15
/15 IL17_HUMAN Interleukin-17A

8b7w[2] A anti-IL-17A-76[125 aa] B 100.0
/98.1 18
/18 IL17_HUMAN Interleukin-17A

8b7w[2] A anti-IL-17A-76[125 aa] B 100.0
/98.1 3
/3 IL17_HUMAN Interleukin-17A

8dy5[2] A spFv CAT2200 LH[244 aa] C 100.0
/98.0 9
/9 IL17_HUMAN Interleukin-17A

5vb9[4] C Peptide inhibitor[15 aa] A 100.0
/98.1 10
/10 IL17_HUMAN Interleukin-17A

5vb9[4] C Peptide inhibitor[15 aa] A 100.0
/98.1 9
/9 IL17_HUMAN Interleukin-17A

5n92[3] A IL17_HUMAN Interleukin-17A[109 aa] B 66.0
/56.5 50
/58 IL17F_HUMAN Interleukin-17F

6ppg[2] C Fab MCAF5352A heavy chain[223 aa] A 33.3
/55.2 3
/3 IL17F_HUMAN Interleukin-17F

6ppg[2] D Fab MCAF5352A heavy chain[226 aa] A 57.1
/55.2 7
/7 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

155 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1jpy[2] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/55.8 2
/2 interleukin 17F

5nan[4] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. E 100.0
/55.8 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[2] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 50.0
/55.2 2
/2 IL17F_HUMAN Interleukin-17F

7uwn[1] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 2
/2 IL17_HUMAN Interleukin-17A

5hi3[2] H 63O
N-(4-{2-[({1-[2-(dimethylamino)-2-oxoethyl]cyclope.. A 100.0
/100.0 5
/5 IL17_HUMAN Interleukin-17A

5hi4[2] H 63P
(9'S,17'R)-6'-chloro-N-methyl-9'-{[(1-methyl-1H-py.. A 100.0
/100.0 11
/11 IL17_HUMAN Interleukin-17A

5hi5[2] H 63Q
(4S,20R)-7-chloro-N-methyl-4-{[(1-methyl-1H-pyrazo.. A 100.0
/100.0 4
/4 IL17_HUMAN Interleukin-17A

7ama[2] C RMK
~{N}-[(2~{S})-1,1-dicyclopropyl-3-[[4-(3,5-dimethy.. A 100.0
/100.0 8
/8 IL17_HUMAN Interleukin-17A

7amg[4] E RMQ
(3~{R})-4-[4-[[(2~{S})-2-[[2,2-bis(fluoranyl)-2-ph.. A 100.0
/100.0 12
/12 IL17_HUMAN Interleukin-17A

7wkx[1] P MLA
MALONIC ACID[7 atoms] E 100.0
/100.0 2
/2 IL17_HUMAN Interleukin-17A

7wkx[1] Q MLA
MALONIC ACID[7 atoms] F 100.0
/100.0 3
/3 IL17_HUMAN Interleukin-17A

8dyf[2] C U5I
(5M)-3-[({2-[2-(2-{2-[2-({[(5M)-3-carboxy-5-(5,8-d.. A 100.0
/99.0 12
/12 IL17_HUMAN Interleukin-17A

8dyg[2] C U5Q
(5P)-2-hydroxy-5-(6-methylquinolin-5-yl)benzoic ac.. A 100.0
/100.0 8
/8 IL17_HUMAN Interleukin-17A

8dyg[2] D U5Q
(5P)-2-hydroxy-5-(6-methylquinolin-5-yl)benzoic ac.. A 100.0
/100.0 2
/2 IL17_HUMAN Interleukin-17A

8dyh[4] C U5X
(5P)-N-benzyl-6-chloro-5-(quinolin-5-yl)pyridin-3-.. A 100.0
/100.0 7
/7 IL17_HUMAN Interleukin-17A

8dyi[4] C U6C
(5P)-5-[5-(benzylamino)pyridin-3-yl]-N-[2-(morphol.. A 100.0
/100.0 6
/6 IL17_HUMAN Interleukin-17A

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

155 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

8dy5[1] G MG
MAGNESIUM ION[1 atoms] D 100.0
/98.1 1
/1 IL17_HUMAN Interleukin-17A

5vb9[2] G CL
CHLORIDE ION[1 atoms] B 100.0
/98.0 2
/2 IL17_HUMAN Interleukin-17A

5vb9[2] G CL
CHLORIDE ION[1 atoms] B 100.0
/98.0 1
/1 IL17_HUMAN Interleukin-17A

3jvf[1] E CA
CALCIUM ION[1 atoms] B 0.0
/55.8 2
/2 IL17F_HUMAN Interleukin-17F

6ppg[2] H CD
CADMIUM ION[1 atoms] A 0.0
/55.2 2
/2 IL17F_HUMAN Interleukin-17F

6ppg[2] I CD
CADMIUM ION[1 atoms] A 0.0
/55.2 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] J CD
CADMIUM ION[1 atoms] A 0.0
/55.2 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] K CD
CADMIUM ION[1 atoms] A 0.0
/55.2 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] L CD
CADMIUM ION[1 atoms] A 0.0
/55.2 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] DB CD
CADMIUM ION[1 atoms] F 100.0
/55.7 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] HB CD
CADMIUM ION[1 atoms] F 100.0
/55.7 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] IB CD
CADMIUM ION[1 atoms] F 100.0
/55.7 1
/1 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

OTHERPOLY

155 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5n92[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/56.5 3
/3 IL17F_HUMAN Interleukin-17F

1jpy[1] E 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. B 100.0
/55.8 2
/2 interleukin 17F

1jpy[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/55.8 3
/3 interleukin 17F

3jvf[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/58.3 3
/3 IL17F_HUMAN Interleukin-17F

6hgo[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/55.8 3
/3 IL17F_HUMAN Interleukin-17F

5nan[1] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be.. F 100.0
/55.8 2
/2 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

155 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2vxs[1] D IL17_HUMAN INTERLEUKIN-17A[77 aa] C 100.0
/100.0 20
/20 IL17_HUMAN INTERLEUKIN-17A

5hhx[2] B IL17_HUMAN Interleukin-17A[10 aa] A 100.0
/100.0 1
/1 IL17_HUMAN Interleukin-17A

7uwn[1] E IL17_HUMAN Interleukin-17A[93 aa] D 100.0
/100.0 41
/41 IL17_HUMAN Interleukin-17A

2vxs[5] B IL17_HUMAN INTERLEUKIN-17A[80 aa] A 100.0
/100.0 20
/20 IL17_HUMAN INTERLEUKIN-17A

4hr9[59] B IL17_HUMAN Interleukin-17A[93 aa] A 100.0
/97.9 41
/41 IL17_HUMAN Interleukin-17A

5hhv[2] B IL17_HUMAN Interleukin-17A[10 aa] A 100.0
/97.8 1
/1 IL17_HUMAN Interleukin-17A

1jpy[16] B interleukin 17F[121 aa] A 63.0
/55.8 54
/64 interleukin 17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

155 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7wkx[1] J ACY
ACETIC ACID[4 atoms] E 100.0
/100.0 3
/3 IL17_HUMAN Interleukin-17A

4qhu[1] L GOL
GLYCEROL[6 atoms] F 100.0
/99.0 3
/3 IL17_HUMAN Interleukin-17A

7z2m[3] N GOL
GLYCEROL[6 atoms] G 100.0
/99.0 1
/1 IL17_HUMAN Interleukin-17A

8dyh[1] D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 2
/2 IL17_HUMAN Interleukin-17A

8dyh[1] D GOL
GLYCEROL[6 atoms] B 100.0
/98.9 3
/3 IL17_HUMAN Interleukin-17A

1jpy[1] H SO4
SULFATE ION[5 atoms] C 50.0
/55.8 2
/2 interleukin 17F

2vxs[4] M SO4
SULFATE ION[5 atoms] A 100.0
/100.0 5
/5 IL17_HUMAN INTERLEUKIN-17A

2vxs[1] O SO4
SULFATE ION[5 atoms] B 100.0
/100.0 2
/2 IL17_HUMAN INTERLEUKIN-17A

4qhu[2] O SO4
SULFATE ION[5 atoms] E 100.0
/99.2 5
/5 IL17_HUMAN Interleukin-17A

4qhu[1] P SO4
SULFATE ION[5 atoms] E 100.0
/99.2 5
/5 IL17_HUMAN Interleukin-17A

6hgo[1] I SO4
SULFATE ION[5 atoms] D 33.3
/55.8 3
/3 IL17F_HUMAN Interleukin-17F

8b7w[4] E SO4
SULFATE ION[5 atoms] B 100.0
/98.1 2
/2 IL17_HUMAN Interleukin-17A

5vb9[4] E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/98.1 4
/4 IL17_HUMAN Interleukin-17A

5vb9[4] E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/98.1 1
/1 IL17_HUMAN Interleukin-17A

5vb9[2] F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/98.1 5
/5 IL17_HUMAN Interleukin-17A

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
155
	pdb_id	a¹	identity[%]²	description
	4qhu	E	99.2	IL17_HUMAN Interleukin-17A
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
155	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	2vxs[6]	E	FAB FRAGMENT[216 aa]	A	100.0 /100.0	6 /6	IL17_HUMAN INTERLEUKIN-17A
	2vxs[6]	F	FAB FRAGMENT[221 aa]	A	100.0 /100.0	6 /6	IL17_HUMAN INTERLEUKIN-17A
	5hhv[2]	C	CAT-2000 FAB heavy chain[220 aa]	A	100.0 /97.8	10 /10	IL17_HUMAN Interleukin-17A
	5hhv[2]	C	CAT-2000 FAB heavy chain[220 aa]	A	100.0 /97.8	5 /5	IL17_HUMAN Interleukin-17A
	5hi3[6]	C	CAT-2000 FAB heavy chain[220 aa]	A	100.0 /100.0	8 /8	IL17_HUMAN Interleukin-17A
	5hi3[6]	E	CAT-2000 FAB heavy chain[220 aa]	A	100.0 /100.0	7 /7	IL17_HUMAN Interleukin-17A
	2vxs[6]	J	FAB FRAGMENT[215 aa]	A	100.0 /100.0	5 /5	IL17_HUMAN INTERLEUKIN-17A
	5hhv[2]	E	CAT-2000 FAB light chain[213 aa]	A	100.0 /97.8	5 /5	IL17_HUMAN Interleukin-17A
	5hi3[6]	D	CAT-2000 FAB light chain[213 aa]	A	100.0 /100.0	5 /5	IL17_HUMAN Interleukin-17A
	5hhv[2]	D	IL-17A peptide inhibitor[14 aa]	A	100.0 /97.8	6 /6	IL17_HUMAN Interleukin-17A
	5hhv[2]	D	IL-17A peptide inhibitor[14 aa]	A	100.0 /97.8	8 /8	IL17_HUMAN Interleukin-17A
	5hhx[2]	D	IL-17A peptide inhibitor[14 aa]	A	100.0 /100.0	6 /6	IL17_HUMAN Interleukin-17A
	5hhx[2]	D	IL-17A peptide inhibitor[14 aa]	A	100.0 /100.0	9 /9	IL17_HUMAN Interleukin-17A
	5hi3[3]	F	synthetic IL-17A peptide inhibitor[14 aa]	A	100.0 /100.0	15 /15	IL17_HUMAN Interleukin-17A
	5hi3[3]	F	synthetic IL-17A peptide inhibitor[14 aa]	B	100.0 /100.0	5 /5	IL17_HUMAN Interleukin-17A
	5n7w[2]	A	Antibody Fragment Heavy Chain[220 aa]	E	100.0 /100.0	5 /5	IL17_HUMAN Interleukin-17A
	5n7w[2]	C	Antibody Fragment Heavy Chain[216 aa]	E	100.0 /100.0	4 /4	IL17_HUMAN Interleukin-17A
	5n7w[2]	B	Antibody Fragment Light Chain[210 aa]	E	100.0 /100.0	4 /4	IL17_HUMAN Interleukin-17A
	5n7w[2]	D	Antibody Fragment Light Chain[211 aa]	E	100.0 /100.0	15 /15	IL17_HUMAN Interleukin-17A
	5n92[3]	B	IL17F_HUMAN Interleukin-17F[120 aa]	A	100.0 /100.0	54 /54	IL17_HUMAN Interleukin-17A
	6wio[4]	A	Fab Heavy chain[230 aa]	C	100.0 /100.0	10 /10	IL17_HUMAN Interleukin-17A
	6wio[4]	A	Fab Heavy chain[230 aa]	C	100.0 /100.0	4 /4	IL17_HUMAN Interleukin-17A
	7uwn[1]	F	I17RA_HUMAN Interleukin-17 receptor A[237 aa]	D	100.0 /100.0	19 /19	IL17_HUMAN Interleukin-17A
	7uwn[1]	F	I17RA_HUMAN Interleukin-17 receptor A[237 aa]	E	100.0 /100.0	24 /24	IL17_HUMAN Interleukin-17A
	7wkx[2]	A	Heavy chain of HB0017 Fab[217 aa]	E	100.0 /100.0	1 /1	IL17_HUMAN Interleukin-17A
	7wkx[2]	B	Heavy chain of HB0017 Fab[212 aa]	E	100.0 /100.0	10 /10	IL17_HUMAN Interleukin-17A
	7wkx[2]	D	Light chain of HB0017 Fab[216 aa]	E	100.0 /100.0	5 /5	IL17_HUMAN Interleukin-17A
	4qhu[2]	A	Fab6785 light chain[209 aa]	E	100.0 /99.2	19 /19	IL17_HUMAN Interleukin-17A
	4qhu[1]	C	Fab6785 light chain[209 aa]	E	100.0 /99.2	3 /3	IL17_HUMAN Interleukin-17A
	4qhu[1]	A	Fab6785 light chain[209 aa]	F	100.0 /99.0	1 /1	IL17_HUMAN Interleukin-17A
	4qhu[2]	B	Fab6785 heavy chain[211 aa]	E	100.0 /99.2	8 /8	IL17_HUMAN Interleukin-17A
	6ppg[2]	B	Fab MCAF5352A light chain[212 aa]	A	100.0 /55.2	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[2]	E	Fab MCAF5352A light chain[216 aa]	A	42.9 /55.2	7 /7	IL17F_HUMAN Interleukin-17F
	6wio[4]	B	Fab Light chain[213 aa]	C	100.0 /100.0	4 /4	IL17_HUMAN Interleukin-17A
	6wio[4]	B	Fab Light chain[213 aa]	C	100.0 /100.0	4 /4	IL17_HUMAN Interleukin-17A
	7z2m[4]	C	11.003 Fab light-chain[213 aa]	G	100.0 /99.0	9 /9	IL17_HUMAN Interleukin-17A
	7z2m[4]	L	11.003 Fab light-chain[213 aa]	G	100.0 /99.0	2 /2	IL17_HUMAN Interleukin-17A
	7z2m[4]	D	11.003 Fab heavy-chain[220 aa]	G	100.0 /99.0	13 /13	IL17_HUMAN Interleukin-17A
	7z2m[1]	D	11.003 Fab heavy-chain[220 aa]	I	100.0 /99.0	2 /2	IL17_HUMAN Interleukin-17A
	8dy1[2]	C	scFv CAT2200 LH[228 aa]	A	100.0 /98.0	7 /7	IL17_HUMAN Interleukin-17A
	3jvf[6]	C	I17RA_HUMAN Interleukin-17 receptor A[271 aa]	A	66.7 /58.3	15 /16	IL17F_HUMAN Interleukin-17F
	3jvf[6]	C	I17RA_HUMAN Interleukin-17 receptor A[271 aa]	B	36.0 /55.8	25 /25	IL17F_HUMAN Interleukin-17F
	4hsa[4]	C	I17RA_HUMAN Interleukin-17 receptor A[272 aa]	A	100.0 /98.1	20 /20	IL17_HUMAN Interleukin-17A
	4hsa[4]	C	I17RA_HUMAN Interleukin-17 receptor A[272 aa]	B	100.0 /98.2	23 /23	IL17_HUMAN Interleukin-17A
	6hg4[4]	B	I17RC_HUMAN Interleukin-17 receptor C[427 aa]	A	52.4 /57.3	21 /21	IL17F_HUMAN Interleukin-17F
	6hg4[4]	B	I17RC_HUMAN Interleukin-17 receptor C[427 aa]	A	75.0 /57.3	16 /16	IL17F_HUMAN Interleukin-17F
	7uwn[1]	G	I17RC_HUMAN Isoform 5 of Interleukin-17 receptor C[403 aa]	A	100.0 /100.0	19 /19	IL17_HUMAN Interleukin-17A
	7uwn[1]	G	I17RC_HUMAN Isoform 5 of Interleukin-17 receptor C[403 aa]	B	100.0 /100.0	9 /9	IL17_HUMAN Interleukin-17A
	7zan[2]	D	I17RC_HUMAN Isoform 2 of Interleukin-17 receptor C[422 aa]	A	100.0 /98.2	20 /20	IL17_HUMAN Interleukin-17A
	7zan[2]	D	I17RC_HUMAN Isoform 2 of Interleukin-17 receptor C[422 aa]	B	100.0 /98.2	15 /15	IL17_HUMAN Interleukin-17A
	8b7w[2]	A	anti-IL-17A-76[125 aa]	B	100.0 /98.1	18 /18	IL17_HUMAN Interleukin-17A
	8b7w[2]	A	anti-IL-17A-76[125 aa]	B	100.0 /98.1	3 /3	IL17_HUMAN Interleukin-17A
	8dy5[2]	A	spFv CAT2200 LH[244 aa]	C	100.0 /98.0	9 /9	IL17_HUMAN Interleukin-17A
	5vb9[4]	C	Peptide inhibitor[15 aa]	A	100.0 /98.1	10 /10	IL17_HUMAN Interleukin-17A
	5vb9[4]	C	Peptide inhibitor[15 aa]	A	100.0 /98.1	9 /9	IL17_HUMAN Interleukin-17A
	5n92[3]	A	IL17_HUMAN Interleukin-17A[109 aa]	B	66.0 /56.5	50 /58	IL17F_HUMAN Interleukin-17F
	6ppg[2]	C	Fab MCAF5352A heavy chain[223 aa]	A	33.3 /55.2	3 /3	IL17F_HUMAN Interleukin-17F
	6ppg[2]	D	Fab MCAF5352A heavy chain[226 aa]	A	57.1 /55.2	7 /7	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
155	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1jpy[2]	G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /55.8	2 /2	interleukin 17F
	5nan[4]	L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	E	100.0 /55.8	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[2]	G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	50.0 /55.2	2 /2	IL17F_HUMAN Interleukin-17F
	7uwn[1]	I	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	2 /2	IL17_HUMAN Interleukin-17A
	5hi3[2]	H	63O N-(4-{2-[({1-[2-(dimethylamino)-2-oxoethyl]cyclope..	A	100.0 /100.0	5 /5	IL17_HUMAN Interleukin-17A
	5hi4[2]	H	63P (9'S,17'R)-6'-chloro-N-methyl-9'-{[(1-methyl-1H-py..	A	100.0 /100.0	11 /11	IL17_HUMAN Interleukin-17A
	5hi5[2]	H	63Q (4S,20R)-7-chloro-N-methyl-4-{[(1-methyl-1H-pyrazo..	A	100.0 /100.0	4 /4	IL17_HUMAN Interleukin-17A
	7ama[2]	C	RMK ~{N}-[(2~{S})-1,1-dicyclopropyl-3-[[4-(3,5-dimethy..	A	100.0 /100.0	8 /8	IL17_HUMAN Interleukin-17A
	7amg[4]	E	RMQ (3~{R})-4-[4-[[(2~{S})-2-[[2,2-bis(fluoranyl)-2-ph..	A	100.0 /100.0	12 /12	IL17_HUMAN Interleukin-17A
	7wkx[1]	P	MLA MALONIC ACID[7 atoms]	E	100.0 /100.0	2 /2	IL17_HUMAN Interleukin-17A
	7wkx[1]	Q	MLA MALONIC ACID[7 atoms]	F	100.0 /100.0	3 /3	IL17_HUMAN Interleukin-17A
	8dyf[2]	C	U5I (5M)-3-[({2-[2-(2-{2-[2-({[(5M)-3-carboxy-5-(5,8-d..	A	100.0 /99.0	12 /12	IL17_HUMAN Interleukin-17A
	8dyg[2]	C	U5Q (5P)-2-hydroxy-5-(6-methylquinolin-5-yl)benzoic ac..	A	100.0 /100.0	8 /8	IL17_HUMAN Interleukin-17A
	8dyg[2]	D	U5Q (5P)-2-hydroxy-5-(6-methylquinolin-5-yl)benzoic ac..	A	100.0 /100.0	2 /2	IL17_HUMAN Interleukin-17A
	8dyh[4]	C	U5X (5P)-N-benzyl-6-chloro-5-(quinolin-5-yl)pyridin-3-..	A	100.0 /100.0	7 /7	IL17_HUMAN Interleukin-17A
	8dyi[4]	C	U6C (5P)-5-[5-(benzylamino)pyridin-3-yl]-N-[2-(morphol..	A	100.0 /100.0	6 /6	IL17_HUMAN Interleukin-17A
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
155	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	8dy5[1]	G	MG MAGNESIUM ION[1 atoms]	D	100.0 /98.1	1 /1	IL17_HUMAN Interleukin-17A
	5vb9[2]	G	CL CHLORIDE ION[1 atoms]	B	100.0 /98.0	2 /2	IL17_HUMAN Interleukin-17A
	5vb9[2]	G	CL CHLORIDE ION[1 atoms]	B	100.0 /98.0	1 /1	IL17_HUMAN Interleukin-17A
	3jvf[1]	E	CA CALCIUM ION[1 atoms]	B	0.0 /55.8	2 /2	IL17F_HUMAN Interleukin-17F
	6ppg[2]	H	CD CADMIUM ION[1 atoms]	A	0.0 /55.2	2 /2	IL17F_HUMAN Interleukin-17F
	6ppg[2]	I	CD CADMIUM ION[1 atoms]	A	0.0 /55.2	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	J	CD CADMIUM ION[1 atoms]	A	0.0 /55.2	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	K	CD CADMIUM ION[1 atoms]	A	0.0 /55.2	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	L	CD CADMIUM ION[1 atoms]	A	0.0 /55.2	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	DB	CD CADMIUM ION[1 atoms]	F	100.0 /55.7	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	HB	CD CADMIUM ION[1 atoms]	F	100.0 /55.7	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	IB	CD CADMIUM ION[1 atoms]	F	100.0 /55.7	1 /1	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
155	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5n92[1]	C	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al..	B	100.0 /56.5	3 /3	IL17F_HUMAN Interleukin-17F
	1jpy[1]	E	2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-..	B	100.0 /55.8	2 /2	interleukin 17F
	1jpy[1]	F	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	C	100.0 /55.8	3 /3	interleukin 17F
	3jvf[1]	D	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	A	100.0 /58.3	3 /3	IL17F_HUMAN Interleukin-17F
	6hgo[1]	E	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	B	100.0 /55.8	3 /3	IL17F_HUMAN Interleukin-17F
	5nan[1]	G	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be..	F	100.0 /55.8	2 /2	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
155	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	2vxs[1]	D	IL17_HUMAN INTERLEUKIN-17A[77 aa]	C	100.0 /100.0	20 /20	IL17_HUMAN INTERLEUKIN-17A
	5hhx[2]	B	IL17_HUMAN Interleukin-17A[10 aa]	A	100.0 /100.0	1 /1	IL17_HUMAN Interleukin-17A
	7uwn[1]	E	IL17_HUMAN Interleukin-17A[93 aa]	D	100.0 /100.0	41 /41	IL17_HUMAN Interleukin-17A
	2vxs[5]	B	IL17_HUMAN INTERLEUKIN-17A[80 aa]	A	100.0 /100.0	20 /20	IL17_HUMAN INTERLEUKIN-17A
	4hr9[59]	B	IL17_HUMAN Interleukin-17A[93 aa]	A	100.0 /97.9	41 /41	IL17_HUMAN Interleukin-17A
	5hhv[2]	B	IL17_HUMAN Interleukin-17A[10 aa]	A	100.0 /97.8	1 /1	IL17_HUMAN Interleukin-17A
	1jpy[16]	B	interleukin 17F[121 aa]	A	63.0 /55.8	54 /64	interleukin 17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
155	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7wkx[1]	J	ACY ACETIC ACID[4 atoms]	E	100.0 /100.0	3 /3	IL17_HUMAN Interleukin-17A
	4qhu[1]	L	GOL GLYCEROL[6 atoms]	F	100.0 /99.0	3 /3	IL17_HUMAN Interleukin-17A
	7z2m[3]	N	GOL GLYCEROL[6 atoms]	G	100.0 /99.0	1 /1	IL17_HUMAN Interleukin-17A
	8dyh[1]	D	GOL GLYCEROL[6 atoms]	A	100.0 /100.0	2 /2	IL17_HUMAN Interleukin-17A
	8dyh[1]	D	GOL GLYCEROL[6 atoms]	B	100.0 /98.9	3 /3	IL17_HUMAN Interleukin-17A
	1jpy[1]	H	SO4 SULFATE ION[5 atoms]	C	50.0 /55.8	2 /2	interleukin 17F
	2vxs[4]	M	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	5 /5	IL17_HUMAN INTERLEUKIN-17A
	2vxs[1]	O	SO4 SULFATE ION[5 atoms]	B	100.0 /100.0	2 /2	IL17_HUMAN INTERLEUKIN-17A
	4qhu[2]	O	SO4 SULFATE ION[5 atoms]	E	100.0 /99.2	5 /5	IL17_HUMAN Interleukin-17A
	4qhu[1]	P	SO4 SULFATE ION[5 atoms]	E	100.0 /99.2	5 /5	IL17_HUMAN Interleukin-17A
	6hgo[1]	I	SO4 SULFATE ION[5 atoms]	D	33.3 /55.8	3 /3	IL17F_HUMAN Interleukin-17F
	8b7w[4]	E	SO4 SULFATE ION[5 atoms]	B	100.0 /98.1	2 /2	IL17_HUMAN Interleukin-17A
	5vb9[4]	E	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /98.1	4 /4	IL17_HUMAN Interleukin-17A
	5vb9[4]	E	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /98.1	1 /1	IL17_HUMAN Interleukin-17A
	5vb9[2]	F	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /98.1	5 /5	IL17_HUMAN Interleukin-17A
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [Q16552(IL17_HUMAN)]